RNF6 Antibody - N-terminal region (ARP37397_T100)

Data Sheet
 
Product Number ARP37397_T100
Product Page www.avivasysbio.com/rnf6-antibody-n-terminal-region-arp37397-t100.html
Name RNF6 Antibody - N-terminal region (ARP37397_T100)
Protein Size (# AA) 667 amino acids
Molecular Weight 73kDa
NCBI Gene Id 74132
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ring finger protein (C3H2C3 type) 6
Alias Symbols AA537053, 1200013I08Rik, 5730419H05Rik
Peptide Sequence Synthetic peptide located within the following region: MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tursun,B., (2005) Genes Dev. 19 (19), 2307-2319
Description of Target Rnf6 is involved in neuronal development. High Rnf6 protein levels can be detected in developing axonal projections of motor and DRG neurons during mouse embryogenesis.
Protein Interactions Limk1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RNF6 (ARP37397_T100) antibody
Blocking Peptide For anti-RNF6 (ARP37397_T100) antibody is Catalog # AAP37397 (Previous Catalog # AAPS05803)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse RNF6
Uniprot ID Q9DBU5
Protein Name E3 ubiquitin-protein ligase RNF6
Protein Accession # NP_083050
Purification Protein A purified
Nucleotide Accession # NM_028774
Tested Species Reactivity Mouse
Gene Symbol RNF6
Predicted Species Reactivity Mouse, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 93%
Image 1
Mouse SP2/0
WB Suggested Anti-RNF6 Antibody Titration: 1.25ug/ml
Positive Control: SP2/0 cell lysate
Image 2
Mouse Pancreas
Mouse Pancreas
Image 3
Mouse intestine
Mouse intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com