Product Number |
ARP37397_T100 |
Product Page |
www.avivasysbio.com/rnf6-antibody-n-terminal-region-arp37397-t100.html |
Name |
RNF6 Antibody - N-terminal region (ARP37397_T100) |
Protein Size (# AA) |
667 amino acids |
Molecular Weight |
73kDa |
NCBI Gene Id |
74132 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ring finger protein (C3H2C3 type) 6 |
Alias Symbols |
AA537053, 1200013I08Rik, 5730419H05Rik |
Peptide Sequence |
Synthetic peptide located within the following region: MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tursun,B., (2005) Genes Dev. 19 (19), 2307-2319 |
Description of Target |
Rnf6 is involved in neuronal development. High Rnf6 protein levels can be detected in developing axonal projections of motor and DRG neurons during mouse embryogenesis. |
Protein Interactions |
Limk1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RNF6 (ARP37397_T100) antibody |
Blocking Peptide |
For anti-RNF6 (ARP37397_T100) antibody is Catalog # AAP37397 (Previous Catalog # AAPS05803) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse RNF6 |
Uniprot ID |
Q9DBU5 |
Protein Name |
E3 ubiquitin-protein ligase RNF6 |
Protein Accession # |
NP_083050 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_028774 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
RNF6 |
Predicted Species Reactivity |
Mouse, Rat |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 93% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-RNF6 Antibody Titration: 1.25ug/ml Positive Control: SP2/0 cell lysate |
| Image 2 | Mouse Pancreas
| Mouse Pancreas |
| Image 3 | Mouse intestine
| Mouse intestine |
|
|