| Product Number |
ARP37395_T100 |
| Product Page |
www.avivasysbio.com/foxp4-antibody-c-terminal-region-arp37395-t100.html |
| Name |
FOXP4 Antibody - C-terminal region (ARP37395_T100) |
| Protein Size (# AA) |
795 amino acids |
| Molecular Weight |
87kDa |
| NCBI Gene Id |
74123 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Forkhead box P4 |
| Alias Symbols |
mFKHLA, 1200010K03Rik, 2310007G05Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: QEDLGVPGEPLPSNGSSSPPRLSPPQYSHQIQVKEEPAEAEEDRRPGPPL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Li,S., et al., (2004) Science 305 (5690), 1619-1622 |
| Description of Target |
Foxp4 is a member of the murine forkhead family of transcription factors. It is expressed exclusively in the epithelial cells of the developing intestine, where, in late development, it is expressed in a gradient along the longitudinal axis of the villi. |
| Protein Interactions |
Foxp3; Pou5f1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FOXP4 (ARP37395_T100) antibody |
| Blocking Peptide |
For anti-FOXP4 (ARP37395_T100) antibody is Catalog # AAP37395 (Previous Catalog # AAPP09938) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q9DBY0 |
| Protein Name |
Forkhead box protein P4 |
| Protein Accession # |
NP_083043 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_028767 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
FOXP4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-FOXP4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: SP2/0 cell lysate |
|
|
