TTC19 Antibody - N-terminal region (ARP37392_T100)

Data Sheet
 
Product Number ARP37392_T100
Product Page www.avivasysbio.com/ttc19-antibody-n-terminal-region-arp37392-t100.html
Name TTC19 Antibody - N-terminal region (ARP37392_T100)
Protein Size (# AA) 352 amino acids
Molecular Weight 39kDa
NCBI Gene Id 72795
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Tetratricopeptide repeat domain 19
Alias Symbols AI505442, 2010204O13Rik, 2810460C24Rik
Peptide Sequence Synthetic peptide located within the following region: RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Powles,N., et al., (2004) Dev. Biol. 268 (1), 24-38
Description of Target TTC19's fucntion is not fully determined yet.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TTC19 (ARP37392_T100) antibody
Blocking Peptide For anti-TTC19 (ARP37392_T100) antibody is Catalog # AAP37392 (Previous Catalog # AAPP09937)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse TTC19
Uniprot ID Q5NCZ4
Protein Name Tetratricopeptide repeat protein 19, mitochondrial
Protein Accession # NP_082636
Purification Protein A purified
Nucleotide Accession # NM_028360
Tested Species Reactivity Mouse
Gene Symbol TTC19
Predicted Species Reactivity Mouse, Rat, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 79%; Yeast: 92%
Image 1
Mouse NIH-3T3
WB Suggested Anti-TTC19 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com