Product Number |
ARP37392_T100 |
Product Page |
www.avivasysbio.com/ttc19-antibody-n-terminal-region-arp37392-t100.html |
Name |
TTC19 Antibody - N-terminal region (ARP37392_T100) |
Protein Size (# AA) |
352 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
72795 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Tetratricopeptide repeat domain 19 |
Alias Symbols |
AI505442, 2010204O13Rik, 2810460C24Rik |
Peptide Sequence |
Synthetic peptide located within the following region: RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Powles,N., et al., (2004) Dev. Biol. 268 (1), 24-38 |
Description of Target |
TTC19's fucntion is not fully determined yet. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TTC19 (ARP37392_T100) antibody |
Blocking Peptide |
For anti-TTC19 (ARP37392_T100) antibody is Catalog # AAP37392 (Previous Catalog # AAPP09937) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse TTC19 |
Uniprot ID |
Q5NCZ4 |
Protein Name |
Tetratricopeptide repeat protein 19, mitochondrial |
Protein Accession # |
NP_082636 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_028360 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
TTC19 |
Predicted Species Reactivity |
Mouse, Rat, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 79%; Yeast: 92% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-TTC19 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: NIH/3T3 cell lysate |
|
|