BRF1 Antibody - C-terminal region (ARP37387_T100)

Data Sheet
 
Product Number ARP37387_T100
Product Page www.avivasysbio.com/brf1-antibody-c-terminal-region-arp37387-t100.html
Name BRF1 Antibody - C-terminal region (ARP37387_T100)
Protein Size (# AA) 203 amino acids
Molecular Weight 22kDa
NCBI Gene Id 72308
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae)
Alias Symbols TAF3, TAFI, GTF3B, TAF3C, TFIII, TAFIII90, TFIIIB90, mTFIIIB90, 2510002F24Rik
Peptide Sequence Synthetic peptide located within the following region: PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target BRF1 is one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BRF1 (ARP37387_T100) antibody
Blocking Peptide For anti-BRF1 (ARP37387_T100) antibody is Catalog # AAP37387 (Previous Catalog # AAPP09934)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q6PED6
Protein Name Brf1 protein EMBL AAH58112.1
Protein Accession # AAH58112
Purification Protein A purified
Nucleotide Accession # NM_028193
Tested Species Reactivity Mouse
Gene Symbol BRF1
Predicted Species Reactivity Mouse, Rat, Cow, Dog
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 92%; Mouse: 100%; Rat: 100%;
Image 1
Mouse NIH-3T3
WB Suggested Anti-BRF1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com