Product Number |
ARP37387_T100 |
Product Page |
www.avivasysbio.com/brf1-antibody-c-terminal-region-arp37387-t100.html |
Name |
BRF1 Antibody - C-terminal region (ARP37387_T100) |
Protein Size (# AA) |
203 amino acids |
Molecular Weight |
22kDa |
NCBI Gene Id |
72308 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae) |
Alias Symbols |
TAF3, TAFI, GTF3B, TAF3C, TFIII, TAFIII90, TFIIIB90, mTFIIIB90, 2510002F24Rik |
Peptide Sequence |
Synthetic peptide located within the following region: PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
Description of Target |
BRF1 is one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-BRF1 (ARP37387_T100) antibody |
Blocking Peptide |
For anti-BRF1 (ARP37387_T100) antibody is Catalog # AAP37387 (Previous Catalog # AAPP09934) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q6PED6 |
Protein Name |
Brf1 protein EMBL AAH58112.1 |
Protein Accession # |
AAH58112 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_028193 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
BRF1 |
Predicted Species Reactivity |
Mouse, Rat, Cow, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 92%; Mouse: 100%; Rat: 100%; |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-BRF1 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: NIH/3T3 cell lysate |
|
|