ISL2 Antibody - C-terminal region (ARP37377_T100)

• Product Number: ARP37377_T100
• Name: ISL2 Antibody - C-terminal region (ARP37377_T100)
• Protein Size (# AA): 359 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 104360
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Insulin related protein 2 (islet 2)
• Alias Symbols: isle, 3110001N10Rik
• Peptide Sequence: Synthetic peptide located within the following region: VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGTPLVAGSPIGH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Svard,J., et al., (2006) Dev. Cell 10 (2), 187-197
• Description of Target: Isl2 specifies RGC laterality by repressing an ipsilateral pathfinding program unique to VTC RGCs and involving Zic2 and EphB1. This genetic hierarchy controls binocular vision.
• Protein Interactions: Zfp446; Ssbp4; Ssbp3; Pygo1; Ssbp2; Lhx4; Ldb2; Ldb1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ISL2 (ARP37377_T100) antibody is Catalog # AAP37377 (Previous Catalog # AAPP09548)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse ISL2
• Uniprot ID: Q9CXV0
• Protein Name: Insulin gene enhancer protein ISL-2
• Protein Accession #: NP_081673
• Purification: Protein A purified
• Nucleotide Accession #: NM_027397
• Tested Species Reactivity: Mouse
• Gene Symbol: ISL2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 86%; Mouse: 93%; Rabbit: 86%; Rat: 93%
• Image 1: Mouse SP2/0
  
  WB Suggested Anti-ISL2 Antibody Titration: 5.0ug/ml
  ELISA Titer: 1:312500
  Positive Control: SP2/0 cell lysate