| Product Number |
ARP37354_T100 |
| Product Page |
www.avivasysbio.com/lass4-antibody-n-terminal-region-arp37354-t100.html |
| Name |
LASS4 Antibody - N-terminal region (ARP37354_T100) |
| Protein Size (# AA) |
393 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
67260 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
LAG1 homolog, ceramide synthase 4 |
| Alias Symbols |
L, Cer, Trh, Trh1, Lass4, 2900019C14Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: LVAVRIVFERFVALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEET |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Riebeling,C., et al., (2003) J. Biol. Chem. 278 (44), 43452-43459 |
| Description of Target |
LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing different fatty acids. |
| Protein Interactions |
Olig1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Cers4 (ARP37354_T100) antibody |
| Blocking Peptide |
For anti-Cers4 (ARP37354_T100) antibody is Catalog # AAP37354 (Previous Catalog # AAPP09533) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q9D6J1 |
| Protein Name |
Ceramide synthase 4 |
| Protein Accession # |
NP_080334 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_026058 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Cers4 |
| Predicted Species Reactivity |
Mouse, Rat, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 79%; Mouse: 100%; Rat: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-LASS4 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate |
|
|
