Use1 Antibody - N-terminal region (ARP37352_T100)

Data Sheet
 
Product Number ARP37352_T100
Product Page www.avivasysbio.com/use1-antibody-n-terminal-region-arp37352-t100.html
Name Use1 Antibody - N-terminal region (ARP37352_T100)
Protein Size (# AA) 270 amino acids
Molecular Weight 30kDa
NCBI Gene Id 67023
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Unconventional SNARE in the ER 1 homolog (S. cerevisiae)
Alias Symbols D12, Ed2, Q-S, p31, Q-snare, AV002165, 2010315L10Rik, 5730403H22Rik
Peptide Sequence Synthetic peptide located within the following region: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Okumura,A.J., J. Biol. Chem. 281 (7), 4495-4506 (2006)
Description of Target cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science laboratory in RIKEN.
Protein Interactions Ubr2; Ubr1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Use1 (ARP37352_T100) antibody
Blocking Peptide For anti-Use1 (ARP37352_T100) antibody is Catalog # AAP37352
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse 2010315L10RIK
Uniprot ID Q9CQ56
Protein Name Vesicle transport protein USE1
Protein Accession # NP_080193
Purification Protein A purified
Nucleotide Accession # NM_025917
Tested Species Reactivity Mouse
Gene Symbol Use1
Predicted Species Reactivity Mouse, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 93%
Image 1
Mouse SP2/0
WB Suggested Antibody Titration: 0.2-1 ug/ml
Positive Control: SP20
Image 2
Mouse Skin
Mouse Skin
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com