Product Number |
ARP37352_T100 |
Product Page |
www.avivasysbio.com/use1-antibody-n-terminal-region-arp37352-t100.html |
Name |
Use1 Antibody - N-terminal region (ARP37352_T100) |
Protein Size (# AA) |
270 amino acids |
Molecular Weight |
30kDa |
NCBI Gene Id |
67023 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Unconventional SNARE in the ER 1 homolog (S. cerevisiae) |
Alias Symbols |
D12, Ed2, Q-S, p31, Q-snare, AV002165, 2010315L10Rik, 5730403H22Rik |
Peptide Sequence |
Synthetic peptide located within the following region: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Okumura,A.J., J. Biol. Chem. 281 (7), 4495-4506 (2006) |
Description of Target |
cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science laboratory in RIKEN. |
Protein Interactions |
Ubr2; Ubr1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Use1 (ARP37352_T100) antibody |
Blocking Peptide |
For anti-Use1 (ARP37352_T100) antibody is Catalog # AAP37352 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse 2010315L10RIK |
Uniprot ID |
Q9CQ56 |
Protein Name |
Vesicle transport protein USE1 |
Protein Accession # |
NP_080193 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_025917 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Use1 |
Predicted Species Reactivity |
Mouse, Rat |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 93% |
Image 1 | Mouse SP2/0
| WB Suggested Antibody Titration: 0.2-1 ug/ml Positive Control: SP20 |
| Image 2 | Mouse Skin
| Mouse Skin |
|
|