Product Number |
ARP37341_P050 |
Product Page |
www.avivasysbio.com/yaf2-antibody-middle-region-arp37341-p050.html |
Name |
YAF2 Antibody - middle region (ARP37341_P050) |
Protein Size (# AA) |
179 amino acids |
Molecular Weight |
20kDa |
NCBI Gene Id |
67057 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
YY1 associated factor 2 |
Alias Symbols |
2810021M11Rik |
Peptide Sequence |
Synthetic peptide located within the following region: GDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kaneko,T., Gene 315, 183-192 (2003) |
Description of Target |
Yaf2 binds to MYC and inhibits MYC-mediated transactivation. Yaf2 also binds to MYCN and enhances MYCN-dependent transcriptional activation. Yaf2 increases calpain 2-mediated proteolysis of YY1 in vitro. Yaf2 is a component of the E2F6.com-1 complex, a repressive complex that methylates Lys-9 of histone H3, suggesting that it is involved in chromatin-remodeling. |
Protein Interactions |
Map3k1; Kdm2b; Rnf2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-YAF2 (ARP37341_P050) antibody |
Blocking Peptide |
For anti-YAF2 (ARP37341_P050) antibody is Catalog # AAP37341 (Previous Catalog # AAPP09788) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse YAF2 |
Uniprot ID |
Q99LW6 |
Protein Name |
YY1-associated factor 2 |
Protein Accession # |
NP_077151 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024189 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
YAF2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 80%; Dog: 80%; Guinea Pig: 80%; Horse: 80%; Human: 80%; Mouse: 100%; Rat: 80% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-YAF2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: NIH/3T3 cell lysate |
|
|