YAF2 Antibody - middle region (ARP37341_P050)

Data Sheet
 
Product Number ARP37341_P050
Product Page www.avivasysbio.com/yaf2-antibody-middle-region-arp37341-p050.html
Name YAF2 Antibody - middle region (ARP37341_P050)
Protein Size (# AA) 179 amino acids
Molecular Weight 20kDa
NCBI Gene Id 67057
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name YY1 associated factor 2
Alias Symbols 2810021M11Rik
Peptide Sequence Synthetic peptide located within the following region: GDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kaneko,T., Gene 315, 183-192 (2003)
Description of Target Yaf2 binds to MYC and inhibits MYC-mediated transactivation. Yaf2 also binds to MYCN and enhances MYCN-dependent transcriptional activation. Yaf2 increases calpain 2-mediated proteolysis of YY1 in vitro. Yaf2 is a component of the E2F6.com-1 complex, a repressive complex that methylates Lys-9 of histone H3, suggesting that it is involved in chromatin-remodeling.
Protein Interactions Map3k1; Kdm2b; Rnf2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-YAF2 (ARP37341_P050) antibody
Blocking Peptide For anti-YAF2 (ARP37341_P050) antibody is Catalog # AAP37341 (Previous Catalog # AAPP09788)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse YAF2
Uniprot ID Q99LW6
Protein Name YY1-associated factor 2
Protein Accession # NP_077151
Purification Affinity Purified
Nucleotide Accession # NM_024189
Tested Species Reactivity Mouse
Gene Symbol YAF2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 80%; Dog: 80%; Guinea Pig: 80%; Horse: 80%; Human: 80%; Mouse: 100%; Rat: 80%
Image 1
Mouse NIH-3T3
WB Suggested Anti-YAF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com