FOXI1 Antibody - N-terminal region (ARP37338_T100)

• Product Number: ARP37338_T100
• Name: FOXI1 Antibody - N-terminal region (ARP37338_T100)
• Protein Size (# AA): 372 amino acids
• Molecular Weight: 41kDa
• NCBI Gene Id: 14233
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Forkhead box I1
• Alias Symbols: Hfh3, Fkh10, HFH-3, FREAC6, 5830401E05Rik
• Peptide Sequence: Synthetic peptide located within the following region: SIGQEPPEMNLYYENFFHPQGMPSPQRPTSFEGGGEYGTTPNPYLWFNGP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kurth,I., et al., (2006) Biochem. J. 393 (PT 1), 277-283
• Description of Target: Mouse Foxi class genes may play important roles, both during cranial placode specification and in later development of individual cranial sensory structures and other organs derived from the cranial ectoderm
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXI1 (ARP37338_T100) antibody is Catalog # AAP37338 (Previous Catalog # AAPP09438)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse FOXI1
• Uniprot ID: Q922I5
• Protein Name: Forkhead box protein I1
• Protein Accession #: NP_076396
• Purification: Protein A purified
• Nucleotide Accession #: NM_023907
• Tested Species Reactivity: Mouse
• Gene Symbol: FOXI1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Guinea Pig: 86%; Human: 86%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-FOXI1 Antibody Titration: 5.0ug/ml
  ELISA Titer: 1:312500
  Positive Control: NIH/3T3 cell lysate