| Product Number |
ARP37320_T100 |
| Product Page |
www.avivasysbio.com/pycard-antibody-middle-region-arp37320-t100.html |
| Name |
PYCARD Antibody - middle region (ARP37320_T100) |
| Protein Size (# AA) |
193 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
66824 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
PYD and CARD domain containing |
| Alias Symbols |
A, Asc, TMS-, TNS1, masc, CARD5, TMS-1, 9130417A21Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: TVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTGHFVDQHRQAL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mariathasan,S., et al., (2004) Nature 430 (6996), 213-218 |
| Description of Target |
Pycard is a cytosolic soluble protein that forms insoluble aggregates and enhances etoposide-induced apoptosis. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PYCARD (ARP37320_T100) antibody |
| Blocking Peptide |
For anti-PYCARD (ARP37320_T100) antibody is Catalog # AAP37320 (Previous Catalog # AAPP09519) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse PYCARD |
| Uniprot ID |
Q9EPB4 |
| Protein Name |
Apoptosis-associated speck-like protein containing a CARD |
| Protein Accession # |
NP_075747 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_023258 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PYCARD |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 86% |
| Image 1 | Human Thymus
 | WB Suggested Anti-PYCARD Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus |
|
|
