TSG101 antibody - middle region (ARP37310_T100)
Data Sheet
Product Number ARP37310_T100
Product Page www.avivasysbio.com/tsg101-antibody-middle-region-arp37310-t100.html
Product Name TSG101 antibody - middle region (ARP37310_T100)
Size 100 ul
Gene Symbol TSG101
Alias Symbols CC2, AI255943
Protein Size (# AA) 391 amino acids
Molecular Weight 43kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 22088
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Tumor susceptibility gene 101
Description This is a rabbit polyclonal antibody against TSG101. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
Target Reference Stefan,M., (er) BMC Genomics 6, 157 (2005)
Description of Target TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
Protein Interactions Nr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-TSG101 (ARP37310_T100) antibody is Catalog # AAP37310 (Previous Catalog # AAPS05712)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Complete computational species homology data Anti-TSG101 (ARP37310_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TSG101.
Swissprot Id Q61187
Protein Name Tumor susceptibility gene 101 protein

Leblanc, P; Arellano-Anaya, ZE; Bernard, E; Gallay, L; Provansal, M; Lehmann, S; Schaeffer, L; Raposo, G; Vilette, D; Isolation of Exosomes and Microvesicles from Cell Culture Systems to Study Prion Transmission. 1545, 153-176 (2017). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27943213

Protein Accession # NP_068684
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TSG101.
Nucleotide Accession # NM_021884
Replacement Item This antibody may replace item sc-101254 from Santa Cruz Biotechnology.
Conjugation Options

ARP37310_T100-FITC Conjugated

ARP37310_T100-HRP Conjugated

ARP37310_T100-Biotin Conjugated

CB Replacement sc-101254; sc-136111; sc-22774; sc-6037; sc-7964
Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Image 1
Mouse Kidney
Rabbit Anti-Tsg101 Antibody
Catalog Number: ARP37310
Paraffin Embedded Tissue: Mouse Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
mouse fibroblast

Sample Type: mouse fibroblast lusate (10ug)
Primary Dilution: 1:1000 (1% BSA)
Secondary Dilution: 1:2000 (5% milk)
Image Submitted By: 
Anonymous researcher 

See Customer Feedback tab for detailed information.

Image 3
Mouse NIH-3T3
WB Suggested Anti-TSG101 Antibody Titration: 1.25ug/ml
Positive Control: NIH/3T3 cell lysate
Image 4
Mouse brain
WB Suggested Anti-TSG101 Antibody
Positive Control: Lane 1: 30ug mouse brain lysate Lane 2: 30ug mouse brain lysate Lane 3: 30ug mouse brain lysate
Primary Antibody Dilution : 1:1000
Secondary Antibody : Goat anti-rabbit-HRP
Secondry Antibody Dilution : 1:50,000
Submitted by: Teresa Gunn, McLaughin Research Institute

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com