TSG101 Antibody - middle region (ARP37310_T100)

• Product Number: ARP37310_T100
• Name: TSG101 Antibody - middle region (ARP37310_T100)
• Protein Size (# AA): 391 amino acids
• Molecular Weight: 43kDa
• NCBI Gene Id: 22088
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Tumor susceptibility gene 101
• Alias Symbols: CC2, AI255943
• Peptide Sequence: Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Stefan,M., (er) BMC Genomics 6, 157 (2005)
• Description of Target: TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
• Protein Interactions: Nr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TSG101 (ARP37310_T100) antibody is Catalog # AAP37310 (Previous Catalog # AAPS05712)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: Q61187
• Protein Name: Tumor susceptibility gene 101 protein
• Publications:

  Isolation of Exosomes and Microvesicles from Cell Culture Systems to Study Prion Transmission. Methods Mol. Biol. 1545, 153-176 (2017). 27943213

• Protein Accession #: NP_068684
• Purification: Protein A purified
• Nucleotide Accession #: NM_021884
• Tested Species Reactivity: Mouse
• Gene Symbol: TSG101
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 100%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-TSG101 Antibody Titration: 1.25ug/ml
  Positive Control: NIH/3T3 cell lysate
• Image 2: Mouse Kidney
  
  Rabbit Anti-Tsg101 Antibody
  Catalog Number: ARP37310
  Paraffin Embedded Tissue: Mouse Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 3: mouse fibroblast
  
  Sample Type: mouse fibroblast lusate (10ug)
  Primary Dilution: 1:1000 (1% BSA)
  Secondary Dilution: 1:2000 (5% milk)
  Image Submitted By: 
  Anonymous researcher See Customer Feedback tab for detailed information.
  
  
• Image 4: Mouse brain
  
  WB Suggested Anti-TSG101 Antibody
  Positive Control: Lane 1: 30ug mouse brain lysate Lane 2: 30ug mouse brain lysate Lane 3: 30ug mouse brain lysate
  Primary Antibody Dilution : 1:1000
  Secondary Antibody : Goat anti-rabbit-HRP
  Secondry Antibody Dilution : 1:50,000
  Submitted by: Teresa Gunn, McLaughin Research Institute