| Product Number |
ARP37305_P050 |
| Product Page |
www.avivasysbio.com/nrip2-antibody-n-terminal-region-arp37305-p050.html |
| Name |
Nrip2 Antibody - N-terminal region (ARP37305_P050) |
| Protein Size (# AA) |
229 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
60345 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nuclear receptor interacting protein 2 |
| Alias Symbols |
NI, NIX1, AW491344 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSTGQEARRDEGDSRKEQEASLRDRAHLSQQRQLKQATQFLHKDSADLLP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
NIX1 holds two copies of the LXXLL motif. NIX1 displays a neuronal specific expression pattern. It selectively interacts with distinct nuclear receptors of the RAR and TR subfamily, but does not bind steroid hormone receptors. By docking to activated nuclear receptors in an AF2-D-dependent fashion, NIX1 might displace coactivators and result in suppression of the transcriptional activity of liganded nuclear receptors. |
| Protein Interactions |
Rorb; Thrb; Rara; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Nrip2 (ARP37305_P050) antibody |
| Blocking Peptide |
For anti-Nrip2 (ARP37305_P050) antibody is Catalog # AAP37305 (Previous Catalog # AAPP09273) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Nrip2 |
| Uniprot ID |
Q9JHR9-2 |
| Protein Name |
Nuclear receptor-interacting protein 2 |
| Protein Accession # |
NP_068363 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021717 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Nrip2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Horse: 86%; Human: 93%; Mouse: 100%; Pig: 77%; Rabbit: 85%; Rat: 93% |
| Image 1 | Mouse Thymus
 | WB Suggested Anti-Nrip2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Thymus |
|
|
