| Product Number |
ARP37289_T100 |
| Product Page |
www.avivasysbio.com/taf1b-antibody-c-terminal-region-arp37289-t100.html |
| Name |
TAF1B Antibody - C-terminal region (ARP37289_T100) |
| Protein Size (# AA) |
586 amino acids |
| Molecular Weight |
64kDa |
| Subunit |
B |
| NCBI Gene Id |
21340 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
TATA box binding protein (Tbp)-associated factor, RNA polymerase I, B |
| Alias Symbols |
p6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A230108M10Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wang,Z., et al., (2004) Gene 325, 25-34 |
| Description of Target |
TAF1b belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs). |
| Protein Interactions |
COPS2; Tbp; Taf1c; Taf1a; Rrn3; Tcf3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TAF1B (ARP37289_T100) antibody |
| Blocking Peptide |
For anti-TAF1B (ARP37289_T100) antibody is Catalog # AAP37289 (Previous Catalog # AAPP20155) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B |
| Uniprot ID |
P97358 |
| Protein Name |
TATA box-binding protein-associated factor RNA polymerase I subunit B |
| Protein Accession # |
NP_065639 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_020614 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
TAF1B |
| Predicted Species Reactivity |
Mouse, Rat, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 82%; Mouse: 100%; Rat: 92% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-TAF1B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate |
|
|
