| Product Number |
ARP37277_P050 |
| Product Page |
www.avivasysbio.com/dnajb12-antibody-n-terminal-region-arp37277-p050.html |
| Name |
Dnajb12 Antibody - N-terminal region (ARP37277_P050) |
| Protein Size (# AA) |
376 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
56709 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DnaJ (Hsp40) homolog, subfamily B, member 12 |
| Alias Symbols |
Dj10, mDj10 |
| Peptide Sequence |
Synthetic peptide located within the following region: NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Dnajb12 (ARP37277_P050) antibody |
| Blocking Peptide |
For anti-Dnajb12 (ARP37277_P050) antibody is Catalog # AAP37277 (Previous Catalog # AAPP23301) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8K037 |
| Protein Name |
DnaJ homolog subfamily B member 12 |
| Protein Accession # |
NP_064349 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_019965 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Dnajb12 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 79% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-Dnajb12 Antibody Titration: 0.2-1 ug/ml
Positive Control: SP2/0 cell lysate |
|
|
