RUNX3 Antibody - C-terminal region (ARP37263_T100)

• Product Number: ARP37263_T100
• Name: RUNX3 Antibody - C-terminal region (ARP37263_T100)
• Protein Size (# AA): 409 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 12399
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Runt related transcription factor 3
• Alias Symbols: AM, Rx, Rx3, AML2, Cbfa, Cbfa3, Pebp2a3
• Peptide Sequence: Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Yarmus,M., et al., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (19), 7384-7389
• Description of Target: RUNX3 belongs to The RUNX family of transcription factors that are important regulators of linage-specific gene expression in major developmental pathways. Runx3 is highly expressed in developing cranial and dorsal root ganglia (DRGs).
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RUNX3 (ARP37263_T100) antibody is Catalog # AAP37263 (Previous Catalog # AAPP09762)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse RUNX3
• Uniprot ID: Q64131
• Protein Accession #: NP_062706
• Purification: Protein A purified
• Nucleotide Accession #: NM_019732
• Tested Species Reactivity: Mouse
• Gene Symbol: RUNX3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 93%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-RUNX3 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:12500
  Positive Control: NIH/3T3 cell lysate