Product Number |
ARP37263_T100 |
Product Page |
www.avivasysbio.com/runx3-antibody-c-terminal-region-arp37263-t100.html |
Name |
RUNX3 Antibody - C-terminal region (ARP37263_T100) |
Protein Size (# AA) |
409 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
12399 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Runt related transcription factor 3 |
Alias Symbols |
AM, Rx, Rx3, AML2, Cbfa, Cbfa3, Pebp2a3 |
Peptide Sequence |
Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yarmus,M., et al., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (19), 7384-7389 |
Description of Target |
RUNX3 belongs to The RUNX family of transcription factors that are important regulators of linage-specific gene expression in major developmental pathways. Runx3 is highly expressed in developing cranial and dorsal root ganglia (DRGs). |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RUNX3 (ARP37263_T100) antibody |
Blocking Peptide |
For anti-RUNX3 (ARP37263_T100) antibody is Catalog # AAP37263 (Previous Catalog # AAPP09762) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse RUNX3 |
Uniprot ID |
Q64131 |
Protein Accession # |
NP_062706 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_019732 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
RUNX3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 93% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-RUNX3 Antibody Titration: 1.25ug/ml ELISA Titer: 1:12500 Positive Control: NIH/3T3 cell lysate |
|
|