Product Number |
ARP37255_T100 |
Product Page |
www.avivasysbio.com/cited4-antibody-n-terminal-region-arp37255-t100.html |
Name |
CITED4 Antibody - N-terminal region (ARP37255_T100) |
Protein Size (# AA) |
182 amino acids |
Molecular Weight |
20kDa |
NCBI Gene Id |
56222 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4 |
Alias Symbols |
Mrg, Mrg2, MRG-2 |
Peptide Sequence |
Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Blackshaw,S., et al., (2004) PLoS Biol. 2 (9), E247 |
Description of Target |
Cited4 is a member of The CITED family proteins that bind to CBP/p300 transcriptional integrators through their conserved C-terminal acidic domain and function as coactivators. It also interacts with isoforms of the TFAP2 transcription factor, coactivating TFAP2-dependent transcription. |
Protein Interactions |
Crebbp; Rbm39; Ivns1abp; Tle6; Sirt1; Cers2; Rai14; Polr3f; Zdhhc6; Ankrd22; Phtf1; Hivep2; Ezh2; Ciita; Hnrnpd; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CITED4 (ARP37255_T100) antibody |
Blocking Peptide |
For anti-CITED4 (ARP37255_T100) antibody is Catalog # AAP37255 (Previous Catalog # AAPP20137) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse CITED4 |
Uniprot ID |
Q9WUL8 |
Protein Name |
Cbp/p300-interacting transactivator 4 |
Protein Accession # |
NP_062509 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_019563 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
CITED4 |
Predicted Species Reactivity |
Mouse, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 100% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-CITED4 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: SP2/0 cell lysate |
|
|