CITED4 Antibody - N-terminal region (ARP37255_T100)

Data Sheet
 
Product Number ARP37255_T100
Product Page www.avivasysbio.com/cited4-antibody-n-terminal-region-arp37255-t100.html
Name CITED4 Antibody - N-terminal region (ARP37255_T100)
Protein Size (# AA) 182 amino acids
Molecular Weight 20kDa
NCBI Gene Id 56222
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4
Alias Symbols Mrg, Mrg2, MRG-2
Peptide Sequence Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Blackshaw,S., et al., (2004) PLoS Biol. 2 (9), E247
Description of Target Cited4 is a member of The CITED family proteins that bind to CBP/p300 transcriptional integrators through their conserved C-terminal acidic domain and function as coactivators. It also interacts with isoforms of the TFAP2 transcription factor, coactivating TFAP2-dependent transcription.
Protein Interactions Crebbp; Rbm39; Ivns1abp; Tle6; Sirt1; Cers2; Rai14; Polr3f; Zdhhc6; Ankrd22; Phtf1; Hivep2; Ezh2; Ciita; Hnrnpd;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CITED4 (ARP37255_T100) antibody
Blocking Peptide For anti-CITED4 (ARP37255_T100) antibody is Catalog # AAP37255 (Previous Catalog # AAPP20137)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse CITED4
Uniprot ID Q9WUL8
Protein Name Cbp/p300-interacting transactivator 4
Protein Accession # NP_062509
Purification Protein A purified
Nucleotide Accession # NM_019563
Tested Species Reactivity Mouse
Gene Symbol CITED4
Predicted Species Reactivity Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 100%
Image 1
Mouse SP2/0
WB Suggested Anti-CITED4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: SP2/0 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com