| Product Number |
ARP37251_T100 |
| Product Page |
www.avivasysbio.com/tbx21-antibody-c-terminal-region-arp37251-t100.html |
| Name |
TBX21 Antibody - C-terminal region (ARP37251_T100) |
| Protein Size (# AA) |
530 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
57765 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
T-box 21 |
| Alias Symbols |
TBT1, Tbet, Tbly, Tblym |
| Peptide Sequence |
Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hirata,T., et al., (2006) Development 133 (8), 1433-1443 |
| Description of Target |
TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells. |
| Protein Interactions |
Bcl6; Smarca4; Tlx3; Tead4; Pax9; Gsc; Gata3; Dlx1; Alx4; Rbpj; Stat1; Ifng; Tec; Itk; Txk; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TBX21 (ARP37251_T100) antibody |
| Blocking Peptide |
For anti-TBX21 (ARP37251_T100) antibody is Catalog # AAP37251 (Previous Catalog # AAPP20136) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse TBX21 |
| Uniprot ID |
Q9JKD8 |
| Protein Name |
T-box transcription factor TBX21 |
| Protein Accession # |
NP_062380 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_019507 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
TBX21 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Human: 93%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Sheep: 86% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-TBX21 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate |
|
|
