Product Number |
ARP37239_P050 |
Product Page |
www.avivasysbio.com/ddx20-antibody-c-terminal-region-arp37239-p050.html |
Name |
Ddx20 Antibody - C-terminal region (ARP37239_P050) |
Protein Size (# AA) |
825 amino acids |
Molecular Weight |
92kDa |
NCBI Gene Id |
53975 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
DEAD (Asp-Glu-Ala-Asp) box polypeptide 20 |
Alias Symbols |
GEMI, dp10, dp103, GEMIN3 |
Peptide Sequence |
Synthetic peptide located within the following region: RRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of Ddx20 remains unknown. |
Protein Interactions |
Etv3; Ncor2; Sin3a; Ncor1; Hdac2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Ddx20 (ARP37239_P050) antibody |
Blocking Peptide |
For anti-Ddx20 (ARP37239_P050) antibody is Catalog # AAP37239 (Previous Catalog # AAPS06208) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of mouse Ddx20
|
Uniprot ID |
Q059Z6 |
Protein Name |
Probable ATP-dependent RNA helicase DDX20 |
Protein Accession # |
NP_059093 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017397 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Ddx20 |
Predicted Species Reactivity |
Mouse, Rat |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 86% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-Ddx20 Antibody Titration: 0.2-1 ug/ml Positive Control: NIH/3T3 cell lysate |
| Image 2 | Mouse Gut
| Sample Type: Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStopPrimary Antibody Dilution: 1:50Secondary Antibody: Goat anti-rabbit-cy3Secondary Antibody Dilution: 1:1500Color/Signal Descriptions: Ddx20: Green Neural crest cells:: RedGene Name: Ddx20Submitted by: Anonymous |
|
|