| Product Number |
ARP37237_T100 |
| Product Page |
www.avivasysbio.com/tef-antibody-n-terminal-region-arp37237-t100.html |
| Name |
TEF Antibody - N-terminal region (ARP37237_T100) |
| Protein Size (# AA) |
301 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
21685 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Thyrotroph embryonic factor |
| Alias Symbols |
2310028D20Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: MSDAGGGKKPPVEPQAGPGPGRAAGERGLSGSFPLVLKKLMENPPRETRL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kaput,J., et al., (2004) (er) Physiol. Genomics 18 (3), 316-324 |
| Description of Target |
TEF (thyrotroph embryonic factor) is a member of the PAR bZip (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It accumulates with robust circadian rhythms in tissues with high amplitudes of clock gene expression. |
| Protein Interactions |
Tef; Dbp; Hes6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TEF (ARP37237_T100) antibody |
| Blocking Peptide |
For anti-TEF (ARP37237_T100) antibody is Catalog # AAP37237 (Previous Catalog # AAPP20130) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse TEF |
| Uniprot ID |
Q9JLC6 |
| Protein Name |
Thyrotroph embryonic factor |
| Publications |
Lee, C. W. et al. Comparison of ADAMTS-1, -4 and -5 expression in culprit plaques between acute myocardial infarction and stable angina. J. Clin. Pathol. 64, 399-404 (2011). 21347262 |
| Protein Accession # |
NP_059072 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_017376 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
TEF |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 93%; Mouse: 100%; Rat: 93%; Sheep: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-TEF Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate |
|
