MYBBP1A Antibody - C-terminal region (ARP37224_T100)

Data Sheet
 
Product Number ARP37224_T100
Product Page www.avivasysbio.com/mybbp1a-antibody-c-terminal-region-arp37224-t100.html
Name MYBBP1A Antibody - C-terminal region (ARP37224_T100)
Protein Size (# AA) 1344 amino acids
Molecular Weight 148kDa
NCBI Gene Id 18432
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name MYB binding protein (P160) 1a
Alias Symbols P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902
Peptide Sequence Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Fan,M., (2004) Genes Dev. 18 (3), 278-289
Description of Target Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Protein Interactions Eed; DSK2; VPS9; NUB1; UBQLN1; SQSTM1; RAD23B; PSMD4; NBR1; L3mbtl2; Ppargc1a; Hdac1; Rnf2; Myod1; Hdac2; Dmrt2; Nanog; Smarca2; Nacc1; Smarca4; Nfe2; Pknox1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MYBBP1A (ARP37224_T100) antibody
Blocking Peptide For anti-MYBBP1A (ARP37224_T100) antibody is Catalog # AAP37224 (Previous Catalog # AAPS06807)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse MYBBP1A
Uniprot ID Q7TPV4
Protein Name Myb-binding protein 1A
Publications

Zheng, B. et al. Establishment of a proteomic profile associated with gonocyte and spermatogonial stem cell maturation and differentiation in neonatal mice. Proteomics 14, 274-85 (2014). 24339256

Protein Accession # NP_058056
Purification Protein A purified
Nucleotide Accession # NM_016776
Tested Species Reactivity Mouse
Gene Symbol MYBBP1A
Predicted Species Reactivity Mouse, Rat, Guinea Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 83%; Mouse: 100%; Rat: 92%
Image 1
Mouse SP2/0
WB Suggested Anti-MYBBP1A Antibody Titration: 1.25ug/ml
Positive Control: SP2/0 cell lysate
Image 2
Mouse Kidney
Mouse Kidney
Image 3
Mouse Lung
Mouse Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com