Product Number |
ARP37224_T100 |
Product Page |
www.avivasysbio.com/mybbp1a-antibody-c-terminal-region-arp37224-t100.html |
Name |
MYBBP1A Antibody - C-terminal region (ARP37224_T100) |
Protein Size (# AA) |
1344 amino acids |
Molecular Weight |
148kDa |
NCBI Gene Id |
18432 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
MYB binding protein (P160) 1a |
Alias Symbols |
P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902 |
Peptide Sequence |
Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Fan,M., (2004) Genes Dev. 18 (3), 278-289 |
Description of Target |
Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity. |
Protein Interactions |
Eed; DSK2; VPS9; NUB1; UBQLN1; SQSTM1; RAD23B; PSMD4; NBR1; L3mbtl2; Ppargc1a; Hdac1; Rnf2; Myod1; Hdac2; Dmrt2; Nanog; Smarca2; Nacc1; Smarca4; Nfe2; Pknox1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MYBBP1A (ARP37224_T100) antibody |
Blocking Peptide |
For anti-MYBBP1A (ARP37224_T100) antibody is Catalog # AAP37224 (Previous Catalog # AAPS06807) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse MYBBP1A |
Uniprot ID |
Q7TPV4 |
Protein Name |
Myb-binding protein 1A |
Publications |
Zheng, B. et al. Establishment of a proteomic profile associated with gonocyte and spermatogonial stem cell maturation and differentiation in neonatal mice. Proteomics 14, 274-85 (2014). 24339256 |
Protein Accession # |
NP_058056 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_016776 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
MYBBP1A |
Predicted Species Reactivity |
Mouse, Rat, Guinea Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 83%; Mouse: 100%; Rat: 92% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-MYBBP1A Antibody Titration: 1.25ug/ml Positive Control: SP2/0 cell lysate |
|
Image 2 | Mouse Kidney
| Mouse Kidney |
|
Image 3 | Mouse Lung
| Mouse Lung |
|