AIP Antibody - N-terminal region (ARP37219_T100)

• Product Number: ARP37219_T100
• Name: AIP Antibody - N-terminal region (ARP37219_T100)
• Protein Size (# AA): 330 amino acids
• Molecular Weight: 36kDa
• NCBI Gene Id: 11632
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Aryl-hydrocarbon receptor-interacting protein
• Alias Symbols: A, Xa, Ara9, Xap2, Fkbp1, Fkbp16, AA408703, AW476050, D19Bwg1412e
• Peptide Sequence: Synthetic peptide located within the following region: REDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Pollenz,R.S. (2005) J. Biol. Chem. 280 (39), 33346-33356
• Description of Target: AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein.
• Protein Interactions: Ahr; Hsp90ab1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-AIP (ARP37219_T100) antibody is Catalog # AAP37219 (Previous Catalog # AAPP20118)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: O08915
• Protein Name: AH receptor-interacting protein
• Protein Accession #: NP_057875
• Purification: Protein A purified
• Nucleotide Accession #: NM_016666
• Tested Species Reactivity: Mouse
• Gene Symbol: AIP
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rat: 100%; Zebrafish: 90%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-AIP Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: NIH/3T3 cell lysate