| Product Number |
ARP37217_P050 |
| Product Page |
www.avivasysbio.com/dmrt1-antibody-c-terminal-region-arp37217-p050.html |
| Name |
Dmrt1 Antibody - C-terminal region (ARP37217_P050) |
| Protein Size (# AA) |
374 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
50796 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Doublesex and mab-3 related transcription factor 1 |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: VFSPPSSQDSGLVSLSSSSPMSNESSKGVLECESASSEPSSYAVNQVLEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Dmrt1 (ARP37217_P050) antibody |
| Blocking Peptide |
For anti-Dmrt1 (ARP37217_P050) antibody is Catalog # AAP37217 (Previous Catalog # AAPS06206) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q6Y951 |
| Protein Name |
Doublesex- and mab-3-related transcription factor 1 |
| Protein Accession # |
NP_056641 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_015826 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Dmrt1 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-Dmrt1 Antibody Titration: 0.2-1 ug/ml
Positive Control: NIH/3T3 cell lysate |
|
|
