| Product Number |
ARP37191_T100 |
| Product Page |
www.avivasysbio.com/ccl5-antibody-middle-region-arp37191-t100.html |
| Name |
CCL5 Antibody - middle region (ARP37191_T100) |
| Protein Size (# AA) |
91 amino acids |
| Molecular Weight |
10kDa |
| NCBI Gene Id |
20304 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Chemokine (C-C motif) ligand 5 |
| Alias Symbols |
S, RA, Scy, MuRa, SISd, Scya5, TCP22, RANTES, TCP228, MuRantes |
| Peptide Sequence |
Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Palaniappan,R., et al., (2006) J. Immunol. 176 (4), 2346-2356 |
| Description of Target |
Recently, it has been shown that genetic polymorphisms can result in diminished expression of CCL5, which results in increased susceptibility to and progression of infectious diseases. CCL5, together with Th cytokine mRNA expression, is temporally up-regulated during pneumococcal carriage. CCL5 is an essential factor for the induction and maintenance of protective pneumococcal immunity |
| Protein Interactions |
Ccr1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CCL5 (ARP37191_T100) antibody |
| Blocking Peptide |
For anti-CCL5 (ARP37191_T100) antibody is Catalog # AAP37191 (Previous Catalog # AAPP08987) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse CCL5 |
| Uniprot ID |
P30882 |
| Protein Name |
C-C motif chemokine 5 |
| Protein Accession # |
NP_038681 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_013653 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
CCL5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 91%; Guinea Pig: 85%; Horse: 85%; Human: 85%; Mouse: 100%; Pig: 91%; Rabbit: 85%; Rat: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-CCL5 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: NIH/3T3 cell lysate |
|
|
