| Product Number |
ARP37186_T100 |
| Product Page |
www.avivasysbio.com/mef2a-antibody-n-terminal-region-arp37186-t100.html |
| Name |
MEF2A Antibody - N-terminal region (ARP37186_T100) |
| Protein Size (# AA) |
498 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
17258 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Myocyte enhancer factor 2A |
| Alias Symbols |
A430079H05Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: ESRTNSDIVETLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNEDSDFIF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Naya,F.J., et al., (2002) Nat. Med. 8 (11), 1303-1309 |
| Description of Target |
MEF2a belongs to MEF2 family. Members of MEF2 family of transcription factors bind a conserved A/T-rich sequence in the control regions of numerous muscle-specific genes |
| Protein Interactions |
Hdac4; Hdac5; Smad2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MEF2A (ARP37186_T100) antibody |
| Blocking Peptide |
For anti-MEF2A (ARP37186_T100) antibody is Catalog # AAP37186 (Previous Catalog # AAPP20109) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse MEF2A |
| Uniprot ID |
Q6P8Q3 |
| Protein Name |
Myocyte-specific enhancer factor 2A |
| Protein Accession # |
NP_038625 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_013597 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
MEF2A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Goat, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-MEF2A Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate |
|
| Image 2 | Mouse Heart
 | Host: Rabbit
Target Name: MEF2A
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml |
|
| Image 3 | Mouse Heart
 | Host: Mouse
Target Name: MEF2A
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml |
|
