IRF5 Antibody - N-terminal region (ARP37180_P050)

• Product Number: ARP37180_P050
• Name: IRF5 Antibody - N-terminal region (ARP37180_P050)
• Protein Size (# AA): 497 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 27056
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Interferon regulatory factor 5
• Alias Symbols: mir, mirf5, AW491843
• Peptide Sequence: Synthetic peptide located within the following region: CSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Takaoka,A., et al., (2005) Nature 434 (7030), 243-249
• Description of Target: The activation of Toll-like receptors (TLRs) is central to innate and adaptive immunity. All TLRs use the adaptor MyD88 for signaling. IRF-5 is generally involved downstream of the TLR-MyD88 signalling pathway for gene induction of proinflammatory cytokines, such as interleukin-6 (IL-6), IL-12 and tumour-necrosis factor-alpha.
• Protein Interactions: Ubc; Traf6; Irak1; Zfp764; Myd88; Il12b;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-IRF5 (ARP37180_P050) antibody is Catalog # AAP37180 (Previous Catalog # AAPP09406)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse IRF5
• Uniprot ID: P56477
• Protein Name: Interferon regulatory factor 5
• Protein Accession #: NP_036187
• Purification: Affinity Purified
• Nucleotide Accession #: NM_012057
• Tested Species Reactivity: Human
• Gene Symbol: IRF5
• Predicted Species Reactivity: Mouse, Rat
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Mouse: 100%; Rat: 100%
• Image 1: Human Lymphnode
  
  WB Suggested Anti-IRF5 Antibody Titration: 0.15ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Lymphnode