| Product Number |
ARP37176_T100 |
| Product Page |
www.avivasysbio.com/sitpec-antibody-middle-region-arp37176-t100.html |
| Name |
SITPEC Antibody - middle region (ARP37176_T100) |
| Protein Size (# AA) |
435 amino acids |
| Molecular Weight |
48kDa |
| NCBI Gene Id |
26940 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
ECSIT homolog (Drosophila) |
| Alias Symbols |
Sit, Sitpec |
| Peptide Sequence |
Synthetic peptide located within the following region: KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Xiao,C., et al., (2003) Genes Dev. 17 (23), 2933-2949 |
| Description of Target |
Sitpec functions as an essential component in two important signal transduction pathways and establishes a novel role for Ecsit as a cofactor for Smad proteins in the bone morphogenetic protein signaling pathway. |
| Protein Interactions |
Map3k1; Traf6; Irak1; SMURF1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ecsit (ARP37176_T100) antibody |
| Blocking Peptide |
For anti-Ecsit (ARP37176_T100) antibody is Catalog # AAP37176 (Previous Catalog # AAPP09403) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse SITPEC |
| Uniprot ID |
Q9QZH6 |
| Protein Name |
Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial |
| Protein Accession # |
NP_036159 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_012029 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Ecsit |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-SITPEC Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate |
|
|
