MTA2 Antibody - middle region (ARP37166_T100)

• Product Number: ARP37166_T100
• Name: MTA2 Antibody - middle region (ARP37166_T100)
• Protein Size (# AA): 668 amino acids
• Molecular Weight: 73kDa
• NCBI Gene Id: 23942
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Metastasis-associated gene family, member 2
• Alias Symbols: Mta1, mmta, mmta2, Mta1l1, Mata1l1, AW550797
• Peptide Sequence: Synthetic peptide located within the following region: AWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Blackshaw,S., et al., (2004) PLoS Biol. 2 (9), E247 (2004)
• Description of Target: MTA2 modulates the enzymatic activity of the histone deacetylase core complex.
• Protein Interactions: Eed; Nanog; L3mbtl2; Hdac1; Mta1; Satb2; Pou5f1; Runx1; RBBP7; RBBP4; Chd4; Mta2; Mbd3; Mbd2; Hdac2; Gata1; Sall4; Tfcp2l1; Esrrb; Zfpm1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MTA2 (ARP37166_T100) antibody is Catalog # AAP37166 (Previous Catalog # AAPP09394)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: Q9R190
• Protein Name: Metastasis-associated protein MTA2
• Protein Accession #: NP_035972
• Purification: Protein A purified
• Nucleotide Accession #: NM_011842
• Tested Species Reactivity: Mouse
• Gene Symbol: MTA2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 93%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Mouse NIH-3T3
  
  WB Suggested Anti-MTA2 Antibody Titration: 5.0ug/ml
  ELISA Titer: 1:312500
  Positive Control: NIH/3T3 cell lysate