| Product Number |
ARP37163_T100 |
| Product Page |
www.avivasysbio.com/trp53-antibody-c-terminal-region-arp37163-t100.html |
| Name |
TRP53 Antibody - C-terminal region (ARP37163_T100) |
| Protein Size (# AA) |
390 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
22059 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transformation related protein 53 |
| Description |
|
| Alias Symbols |
p4, p5, bbl, bfy, bhy, p44, p53, Tp53 |
| Peptide Sequence |
Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Rotter,V., et al., (1984) Mol. Cell. Biol. 4 (2), 383-385 |
| Description of Target |
Trp53 is a protein found in elevated levels in a great variety of transformed cells |
| Protein Interactions |
PRKAA1; Rnf128; Ndn; Herc2; Rchy1; Rps26; Rpl11; Cdkn2a; Bcl2l1; Daxx; Mdm2; Wwox; Mapk8; Smyd1; Ubc; Twist1; Pten; Bard1; Ep300; Sumo1; Trp73; Trp63; Strm; Nqo1; Mif; Hspa1b; Hipk2; Axin1; Zbtb7c; Topors; Gsk3b; Foxp3; Huwe1; Park7; Ccng1; NUMB; Skil; Cu |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRP53 (ARP37163_T100) antibody |
| Blocking Peptide |
For anti-TRP53 (ARP37163_T100) antibody is Catalog # AAP37163 (Previous Catalog # AAPP09391) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
P02340 |
| Protein Name |
Cellular tumor antigen p53 |
| Publications |
Methylsulfonylmethane inhibits cortisol-induced stress through p53-mediated SDHA/HPRT1 expression in racehorse skeletal muscle cells: A primary step against exercise stress. Exp Ther Med. 19, 214-222 (2020). 31853292 |
| Protein Accession # |
NP_035770 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_011640 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
TRP53 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%; Sheep: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-TRP53 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate |
|
| Image 2 | Mouse
 | WB Suggested Anti-TRP53 Antibody
Positive Control: Lane 1: 40ug C57/B6 control mouse G.I.
Lane 2: 40ug C57/B6 mouse G.I. treated with Irinotecan
Lane 3: 40ug p53 KO HCT-116 cells
Lane 4: 40ug C57/B6 mouse treated with 15 Gy ionizing radiation
Primary Antibody Dilution : 1:1000
Secondary Antibody : Goat anti-rabbit-HRP
Secondry Antibody Dilution : 1:2500
Submitted by: Brian Leibowitz, University of Pittsburgh |
|
