Tgfb1 Antibody - middle region (ARP37156_T100)

Data Sheet
 
Product Number ARP37156_T100
Product Page www.avivasysbio.com/tgfb1-antibody-middle-region-arp37156-t100.html
Name Tgfb1 Antibody - middle region (ARP37156_T100)
Protein Size (# AA) 390 amino acids
Molecular Weight 42kDa
NCBI Gene Id 21803
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transforming growth factor, beta 1
Alias Symbols Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1
Peptide Sequence Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
Protein Interactions Htra1; Nrep; Ltbp3; Col1a1; Tgfbr3; Tgfbr1; Tgfbr2; Smad4; Hdac3; Jun;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Tgfb1 (ARP37156_T100) antibody
Blocking Peptide For anti-Tgfb1 (ARP37156_T100) antibody is Catalog # AAP37156 (Previous Catalog # AAPP10723)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse Tgfb1
Uniprot ID P01137
Protein Name Transforming growth factor beta-1
Protein Accession # NP_035707
Purification Protein A purified
Nucleotide Accession # NM_011577
Tested Species Reactivity Mouse
Gene Symbol Tgfb1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Image 1
Mouse Lymphnode
WB Suggested Anti-Tgfb1 Antibody Titration: 1.25ug/ml
Positive Control: Mouse Lymphnode
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com