Product Number |
ARP37156_T100 |
Product Page |
www.avivasysbio.com/tgfb1-antibody-middle-region-arp37156-t100.html |
Name |
Tgfb1 Antibody - middle region (ARP37156_T100) |
Protein Size (# AA) |
390 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
21803 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Transforming growth factor, beta 1 |
Alias Symbols |
Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-beta1 |
Peptide Sequence |
Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. |
Protein Interactions |
Htra1; Nrep; Ltbp3; Col1a1; Tgfbr3; Tgfbr1; Tgfbr2; Smad4; Hdac3; Jun; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Tgfb1 (ARP37156_T100) antibody |
Blocking Peptide |
For anti-Tgfb1 (ARP37156_T100) antibody is Catalog # AAP37156 (Previous Catalog # AAPP10723) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Tgfb1 |
Uniprot ID |
P01137 |
Protein Name |
Transforming growth factor beta-1 |
Protein Accession # |
NP_035707 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_011577 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Tgfb1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
Image 1 | Mouse Lymphnode
| WB Suggested Anti-Tgfb1 Antibody Titration: 1.25ug/ml Positive Control: Mouse Lymphnode |
|