| Product Number |
ARP37146_T100 |
| Product Page |
www.avivasysbio.com/stat5b-antibody-middle-region-arp37146-t100.html |
| Name |
STAT5B Antibody - middle region (ARP37146_T100) |
| Protein Size (# AA) |
786 amino acids |
| Molecular Weight |
86kDa |
| NCBI Gene Id |
20851 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Signal transducer and activator of transcription 5B |
| Peptide Sequence |
Synthetic peptide located within the following region: GTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Laloraya,M., et al., (2006) Diabetes 55 (3), 734-741 |
| Description of Target |
Stat5 is a member of the STAT family. It mediates signaling of many cytokines and growth factors |
| Protein Interactions |
GHR; Jak2; INSR; Hoxb8; Stat5a; CENPJ; Epor; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-STAT5B (ARP37146_T100) antibody |
| Additional Information |
IHC Information: Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Blocking Peptide |
For anti-STAT5B (ARP37146_T100) antibody is Catalog # AAP37146 (Previous Catalog # AAPP09954) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse STAT5B |
| Uniprot ID |
P42232 |
| Protein Name |
Signal transducer and activator of transcription 5B |
| Protein Accession # |
NP_035619 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_011489 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
STAT5B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Goat: 86%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 86%; Zebrafish: 93% |
| Image 1 | Human
 | WB Suggested Anti-STAT5B Antibody Titration: 5.0ug/ml
Positive Control: Muscle lysate |
|
| Image 2 | Human Prostate
 | Human Prostate |
|
| Image 3 | Human Prostate
 | Human Prostate |
|
