Product Number |
ARP37145_P050 |
Product Page |
www.avivasysbio.com/srebf1-antibody-n-terminal-region-arp37145-p050.html |
Name |
SREBF1 Antibody - N-terminal region (ARP37145_P050) |
Protein Size (# AA) |
1134 amino acids |
Molecular Weight |
125kDa |
NCBI Gene Id |
20787 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Sterol regulatory element binding transcription factor 1 |
Alias Symbols |
SRE, ADD-, ADD1, SREB, SREBP, bHLHd, SREBP1, bHLHd1 |
Peptide Sequence |
Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Briancon,N. (2006) EMBO J. 25 (6), 1253-1262 |
Description of Target |
Srebf1 is transcriptional activator that binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Srebf1 also binds to an E-box motif (5'-ATCACGTGA-3'). Srebf1 regulates the transcription of genes for sterol biosynthesis and the LDL receptor gene. |
Protein Interactions |
Rnf20; Zbtb7c; Ppargc1b; Rela; Ewsr1; Pcbd1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SREBF1 (ARP37145_P050) antibody |
Blocking Peptide |
For anti-SREBF1 (ARP37145_P050) antibody is Catalog # AAP37145 (Previous Catalog # AAPP09373) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse SREBF1 |
Uniprot ID |
Q9WTN3 |
Protein Name |
Sterol regulatory element-binding protein 1 |
Protein Accession # |
NP_035610 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_011480 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
SREBF1 |
Predicted Species Reactivity |
Mouse, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 93% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-SREBF1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: SP2/0 cell lysate |
|
Image 2 | mouse glomerular endothelial
| WB Suggested Anti-SREBF1 Antibody Positive Control: Lane 1: 50ug mouse glomerular endothelial lysate Lane 2: 50ug mouse glomerular endothelial lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit-HRP Secondry Antibody Dilution : 1:5000 Submitted by: Xiaoxin Wang, UC Denver |
|