SREBF1 Antibody - N-terminal region (ARP37145_P050)

Data Sheet
 
Product Number ARP37145_P050
Product Page www.avivasysbio.com/srebf1-antibody-n-terminal-region-arp37145-p050.html
Name SREBF1 Antibody - N-terminal region (ARP37145_P050)
Protein Size (# AA) 1134 amino acids
Molecular Weight 125kDa
NCBI Gene Id 20787
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sterol regulatory element binding transcription factor 1
Alias Symbols SRE, ADD-, ADD1, SREB, SREBP, bHLHd, SREBP1, bHLHd1
Peptide Sequence Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Briancon,N. (2006) EMBO J. 25 (6), 1253-1262
Description of Target Srebf1 is transcriptional activator that binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Srebf1 also binds to an E-box motif (5'-ATCACGTGA-3'). Srebf1 regulates the transcription of genes for sterol biosynthesis and the LDL receptor gene.
Protein Interactions Rnf20; Zbtb7c; Ppargc1b; Rela; Ewsr1; Pcbd1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SREBF1 (ARP37145_P050) antibody
Blocking Peptide For anti-SREBF1 (ARP37145_P050) antibody is Catalog # AAP37145 (Previous Catalog # AAPP09373)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse SREBF1
Uniprot ID Q9WTN3
Protein Name Sterol regulatory element-binding protein 1
Protein Accession # NP_035610
Purification Affinity Purified
Nucleotide Accession # NM_011480
Tested Species Reactivity Mouse
Gene Symbol SREBF1
Predicted Species Reactivity Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 93%
Image 1
Mouse SP2/0
WB Suggested Anti-SREBF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: SP2/0 cell lysate
Image 2
mouse glomerular endothelial
WB Suggested Anti-SREBF1 Antibody
Positive Control: Lane 1: 50ug mouse glomerular endothelial lysate Lane 2: 50ug mouse glomerular endothelial lysate
Primary Antibody Dilution : 1:1000
Secondary Antibody : Anti-rabbit-HRP
Secondry Antibody Dilution : 1:5000
Submitted by: Xiaoxin Wang, UC Denver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com