| Product Number |
ARP37139_T100 |
| Product Page |
www.avivasysbio.com/sox7-antibody-n-terminal-region-arp37139-t100.html |
| Name |
SOX7 Antibody - N-terminal region (ARP37139_T100) |
| Protein Size (# AA) |
380 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
20680 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
SRY-box containing gene 7 |
| Peptide Sequence |
Synthetic peptide located within the following region: LGAYPWTEGLECPALEAELSDGLSPPAVPRPSGDKSSESRIRRPMNAFMV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wilson,M.E., et al., (2005) Diabetes 54 (12), 3402-3409 |
| Description of Target |
SOX7 belongs to the SOX family of transcription factors bind PS4A and differentially modulate transcription. It is a potent activator of Fgf-3 transcription. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SOX7 (ARP37139_T100) antibody |
| Blocking Peptide |
For anti-SOX7 (ARP37139_T100) antibody is Catalog # AAP37139 (Previous Catalog # AAPP09367) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse SOX7 |
| Uniprot ID |
P40646 |
| Protein Name |
Transcription factor SOX-7 |
| Protein Accession # |
NP_035576 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_011446 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
SOX7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Human: 86%; Mouse: 100%; Pig: 79%; Rat: 93% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-SOX7 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: SP2/0 cell lysate |
|
|
