Product Number |
ARP37130_T100 |
Product Page |
www.avivasysbio.com/khdrbs1-antibody-n-terminal-region-arp37130-t100.html |
Name |
KHDRBS1 Antibody - N-terminal region (ARP37130_T100) |
Protein Size (# AA) |
443 amino acids |
Molecular Weight |
49kDa |
NCBI Gene Id |
20218 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
KH domain containing, RNA binding, signal transduction associated 1 |
Alias Symbols |
p6, Sam, p62, p68, Sam68 |
Peptide Sequence |
Synthetic peptide located within the following region: MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Paronetto,M.P., et al., (2006) Mol. Biol. Cell 17 (1), 14-24 |
Description of Target |
Khdrbs1 functions as a transcriptional repressor and may link cellular signaling pathways with components of the transcriptional machinery. It shuttles between the nucleus and the cytoplasm in secondary spermatocytes, suggesting that it may promote translation of specific RNA targets during the meiotic divisions. |
Protein Interactions |
Rasa1; Yes1; Src; Lyn; Fyn; SH3KBP1; Cd40; Ripk1; TRAF2; Ncoa5; Rbm39; Gtf2e2; Khdrbs1; Grb2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KHDRBS1 (ARP37130_T100) antibody |
Blocking Peptide |
For anti-KHDRBS1 (ARP37130_T100) antibody is Catalog # AAP37130 (Previous Catalog # AAPP09358) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse KHDRBS1 |
Uniprot ID |
Q60749 |
Protein Name |
KH domain-containing, RNA-binding, signal transduction-associated protein 1 |
Protein Accession # |
NP_035447 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_011317 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
KHDRBS1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 86%; Human: 86%; Mouse: 100%; Pig: 92%; Rabbit: 86%; Rat: 100% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-KHDRBS1 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: NIH/3T3 cell lysate |
|
|