KHDRBS1 Antibody - N-terminal region (ARP37130_T100)

Data Sheet
 
Product Number ARP37130_T100
Product Page www.avivasysbio.com/khdrbs1-antibody-n-terminal-region-arp37130-t100.html
Name KHDRBS1 Antibody - N-terminal region (ARP37130_T100)
Protein Size (# AA) 443 amino acids
Molecular Weight 49kDa
NCBI Gene Id 20218
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name KH domain containing, RNA binding, signal transduction associated 1
Alias Symbols p6, Sam, p62, p68, Sam68
Peptide Sequence Synthetic peptide located within the following region: MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Paronetto,M.P., et al., (2006) Mol. Biol. Cell 17 (1), 14-24
Description of Target Khdrbs1 functions as a transcriptional repressor and may link cellular signaling pathways with components of the transcriptional machinery. It shuttles between the nucleus and the cytoplasm in secondary spermatocytes, suggesting that it may promote translation of specific RNA targets during the meiotic divisions.
Protein Interactions Rasa1; Yes1; Src; Lyn; Fyn; SH3KBP1; Cd40; Ripk1; TRAF2; Ncoa5; Rbm39; Gtf2e2; Khdrbs1; Grb2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KHDRBS1 (ARP37130_T100) antibody
Blocking Peptide For anti-KHDRBS1 (ARP37130_T100) antibody is Catalog # AAP37130 (Previous Catalog # AAPP09358)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse KHDRBS1
Uniprot ID Q60749
Protein Name KH domain-containing, RNA-binding, signal transduction-associated protein 1
Protein Accession # NP_035447
Purification Protein A purified
Nucleotide Accession # NM_011317
Tested Species Reactivity Mouse
Gene Symbol KHDRBS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 86%; Human: 86%; Mouse: 100%; Pig: 92%; Rabbit: 86%; Rat: 100%
Image 1
Mouse NIH-3T3
WB Suggested Anti-KHDRBS1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com