Product Number |
ARP37110_P050 |
Product Page |
www.avivasysbio.com/nkx2-2-antibody-n-terminal-region-arp37110-p050.html |
Name |
NKX2-2 Antibody - N-terminal region (ARP37110_P050) |
Protein Size (# AA) |
273 amino acids |
Molecular Weight |
30kDa |
NCBI Gene Id |
18088 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
NK2 transcription factor related, locus 2 (Drosophila) |
Alias Symbols |
ti, Nkx2., Nkx-2., Nkx2.2, tinman, Nkx-2.2 |
Peptide Sequence |
Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sun,T., et al., (2006) Dev. Biol. 292 (1), 152-164 |
Description of Target |
Nkx2-2 contains 1 homeobox DNA-binding domain which is essential for interaction with OLIG2. Nkx2-2 may be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. |
Protein Interactions |
Tle3; Gata6; Olig2; Tlx3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NKX2-2 (ARP37110_P050) antibody |
Blocking Peptide |
For anti-NKX2-2 (ARP37110_P050) antibody is Catalog # AAP37110 (Previous Catalog # AAPP09338) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
P42586 |
Protein Name |
Homeobox protein Nkx-2.2 |
Protein Accession # |
NP_035049 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_010919 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
NKX2-2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-NKX2-2 Antibody Titration: 0.125ug/ml ELISA Titer: 1:1562500 Positive Control: SP2/0 cell lysate |
|