NKX2-2 Antibody - N-terminal region (ARP37110_P050)

Data Sheet
 
Product Number ARP37110_P050
Product Page www.avivasysbio.com/nkx2-2-antibody-n-terminal-region-arp37110-p050.html
Name NKX2-2 Antibody - N-terminal region (ARP37110_P050)
Protein Size (# AA) 273 amino acids
Molecular Weight 30kDa
NCBI Gene Id 18088
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NK2 transcription factor related, locus 2 (Drosophila)
Alias Symbols ti, Nkx2., Nkx-2., Nkx2.2, tinman, Nkx-2.2
Peptide Sequence Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sun,T., et al., (2006) Dev. Biol. 292 (1), 152-164
Description of Target Nkx2-2 contains 1 homeobox DNA-binding domain which is essential for interaction with OLIG2. Nkx2-2 may be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance.
Protein Interactions Tle3; Gata6; Olig2; Tlx3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NKX2-2 (ARP37110_P050) antibody
Blocking Peptide For anti-NKX2-2 (ARP37110_P050) antibody is Catalog # AAP37110 (Previous Catalog # AAPP09338)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID P42586
Protein Name Homeobox protein Nkx-2.2
Protein Accession # NP_035049
Purification Affinity Purified
Nucleotide Accession # NM_010919
Tested Species Reactivity Mouse
Gene Symbol NKX2-2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Image 1
Mouse SP2/0
WB Suggested Anti-NKX2-2 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:1562500
Positive Control: SP2/0 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com