Product Number |
ARP37106_T100 |
Product Page |
www.avivasysbio.com/nfatc2-antibody-n-terminal-region-arp37106-t100.html |
Name |
NFATC2 Antibody - N-terminal region (ARP37106_T100) |
Protein Size (# AA) |
927 amino acids |
Molecular Weight |
100kDa |
NCBI Gene Id |
18019 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 2 |
Alias Symbols |
NF, NFA, NFAT1, Nfatp, NF-ATp, NF-ATc2, NFAT1-D, AI607462 |
Peptide Sequence |
Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Glud,S.Z., et al., (2005) Blood 106 (10), 3546-3552 |
Description of Target |
NFATC2 is a member of The NF-AT family of potent transcription factors that are essential for T cell activation |
Protein Interactions |
Foxp3; Il4; Ifng; Nfatc2ip; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NFATC2 (ARP37106_T100) antibody |
Blocking Peptide |
For anti-NFATC2 (ARP37106_T100) antibody is Catalog # AAP37106 (Previous Catalog # AAPP09334) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse NFATC2 |
Uniprot ID |
Q60591-3 |
Protein Name |
Nuclear factor of activated T-cells, cytoplasmic 2 |
Publications |
Heer, R. et al. Phenotypic modulation of human urinary tract stroma-derived fibroblasts by transforming growth factor beta3. Urology 76, 509.e13-20 (2010). 20546875
Nagamoto-Combs, K. & Combs, C. K. Microglial phenotype is regulated by activity of the transcription factor, NFAT (nuclear factor of activated T cells). J. Neurosci. 30, 9641-6 (2010). 20631193 |
Protein Accession # |
NP_035029 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_010899 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
NFATC2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 82%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 79%; Rat: 93% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-NFATC2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: SP2/0 cell lysate |
|