NFATC2 Antibody - N-terminal region (ARP37106_T100)

Data Sheet
 
Product Number ARP37106_T100
Product Page www.avivasysbio.com/nfatc2-antibody-n-terminal-region-arp37106-t100.html
Name NFATC2 Antibody - N-terminal region (ARP37106_T100)
Protein Size (# AA) 927 amino acids
Molecular Weight 100kDa
NCBI Gene Id 18019
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 2
Alias Symbols NF, NFA, NFAT1, Nfatp, NF-ATp, NF-ATc2, NFAT1-D, AI607462
Peptide Sequence Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Glud,S.Z., et al., (2005) Blood 106 (10), 3546-3552
Description of Target NFATC2 is a member of The NF-AT family of potent transcription factors that are essential for T cell activation
Protein Interactions Foxp3; Il4; Ifng; Nfatc2ip;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NFATC2 (ARP37106_T100) antibody
Blocking Peptide For anti-NFATC2 (ARP37106_T100) antibody is Catalog # AAP37106 (Previous Catalog # AAPP09334)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse NFATC2
Uniprot ID Q60591-3
Protein Name Nuclear factor of activated T-cells, cytoplasmic 2
Publications

Heer, R. et al. Phenotypic modulation of human urinary tract stroma-derived fibroblasts by transforming growth factor beta3. Urology 76, 509.e13-20 (2010). 20546875

Nagamoto-Combs, K. & Combs, C. K. Microglial phenotype is regulated by activity of the transcription factor, NFAT (nuclear factor of activated T cells). J. Neurosci. 30, 9641-6 (2010). 20631193

Protein Accession # NP_035029
Purification Protein A purified
Nucleotide Accession # NM_010899
Tested Species Reactivity Mouse
Gene Symbol NFATC2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 82%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 79%; Rat: 93%
Image 1
Mouse SP2/0
WB Suggested Anti-NFATC2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com