| Product Number |
ARP37094_T100 |
| Product Page |
www.avivasysbio.com/msx1-antibody-n-terminal-region-arp37094-t100.html |
| Name |
MSX1 Antibody - N-terminal region (ARP37094_T100) |
| Protein Size (# AA) |
299 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
17701 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Homeobox, msh-like 1 |
| Description |
|
| Alias Symbols |
ms, Hox, msh, Hox-, Hox7, Hox-7, Hox7., Hox7.1, AA675338, AI324650 |
| Peptide Sequence |
Synthetic peptide located within the following region: KPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lee,H., et al., (2006) Genes Dev. 20 (7), 784-794 |
| Description of Target |
MSX1 belongs to the MSX family. MSX and DLX are members of the Antennapedia class of non-Hox homeodomain transcription factors that regulate gene expression and influence development of the craniofacial structures and anterior forebrain. |
| Protein Interactions |
Mc5r; Mc4r; Mc3r; Mc1r; Hist1h1a; Hist1h1b; Hist1h1e; Tle4; Pou2f1; Msx1; Aes; Tbp; Dlx2; Gmnn; Pax9; Myod1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MSX1 (ARP37094_T100) antibody |
| Blocking Peptide |
For anti-MSX1 (ARP37094_T100) antibody is Catalog # AAP37094 (Previous Catalog # AAPP09322) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse MSX1 |
| Uniprot ID |
P13297 |
| Protein Name |
Homeobox protein MSX-1 |
| Publications |
Necdin, a Prader-Willi syndrome candidate gene, regulates gonadotropin-releasing hormone neurons during development. Hum Mol Genet. 18, 248-60 (2009). 18930956 |
| Protein Accession # |
NP_034965 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_010835 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
MSX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-MSX1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: SP2/0 cell lysate |
|
