| Product Number |
ARP37086_P050 |
| Product Page |
www.avivasysbio.com/mxd1-antibody-c-terminal-region-arp37086-p050.html |
| Name |
Mxd1 Antibody - C-terminal region (ARP37086_P050) |
| Protein Size (# AA) |
226 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
17119 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
MAX dimerization protein 1 |
| Alias Symbols |
Ma, Mad, Mad1, AW122478 |
| Peptide Sequence |
Synthetic peptide located within the following region: TQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQVKARHKEGANQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Mxd1 remains unknown. |
| Protein Interactions |
Max; Smc3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Mxd1 (ARP37086_P050) antibody |
| Blocking Peptide |
For anti-Mxd1 (ARP37086_P050) antibody is Catalog # AAP37086 (Previous Catalog # AAPP10707) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
P50538 |
| Protein Accession # |
NP_034881 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_010751 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Mxd1 |
| Predicted Species Reactivity |
Mouse, Rat, Cow, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Mouse: 100%; Rabbit: 86%; Rat: 93% |
| Image 1 | Mouse Spleen
 | WB Suggested Anti-Mxd1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Spleen |
|
|
