Product Number |
ARP37068_P050 |
Product Page |
www.avivasysbio.com/hoxb7-antibody-middle-region-arp37068-p050.html |
Name |
Hoxb7 Antibody - middle region (ARP37068_P050) |
Protein Size (# AA) |
217 amino acids |
Molecular Weight |
24kDa |
NCBI Gene Id |
15415 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Homeobox B7 |
Alias Symbols |
Hox-2., Hox-2.3, AI325018 |
Peptide Sequence |
Synthetic peptide located within the following region: PGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Hoxb7 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. |
Protein Interactions |
Gmnn; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Hoxb7 (ARP37068_P050) antibody |
Blocking Peptide |
For anti-Hoxb7 (ARP37068_P050) antibody is Catalog # AAPP09886 |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
P09024 |
Protein Name |
Homeobox protein Hox-B7 |
Protein Accession # |
NP_034590 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_010460 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Hoxb7 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-Hoxb7 Antibody Titration: 1.0 ug/ml Positive Control: NIH3T3 |
|
|