Hoxb7 Antibody - middle region (ARP37068_P050)

Data Sheet
 
Product Number ARP37068_P050
Product Page www.avivasysbio.com/hoxb7-antibody-middle-region-arp37068-p050.html
Name Hoxb7 Antibody - middle region (ARP37068_P050)
Protein Size (# AA) 217 amino acids
Molecular Weight 24kDa
NCBI Gene Id 15415
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox B7
Alias Symbols Hox-2., Hox-2.3, AI325018
Peptide Sequence Synthetic peptide located within the following region: PGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Hoxb7 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Protein Interactions Gmnn;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Hoxb7 (ARP37068_P050) antibody
Blocking Peptide For anti-Hoxb7 (ARP37068_P050) antibody is Catalog # AAPP09886
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID P09024
Protein Name Homeobox protein Hox-B7
Protein Accession # NP_034590
Purification Affinity Purified
Nucleotide Accession # NM_010460
Tested Species Reactivity Mouse
Gene Symbol Hoxb7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Mouse NIH-3T3
WB Suggested Anti-Hoxb7 Antibody
Titration: 1.0 ug/ml
Positive Control: NIH3T3
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com