Product Number |
ARP37058_P050 |
Product Page |
www.avivasysbio.com/hmg20b-antibody-n-terminal-region-arp37058-p050.html |
Name |
HMG20B Antibody - N-terminal region (ARP37058_P050) |
Protein Size (# AA) |
317 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
15353 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
High mobility group 20 B |
Alias Symbols |
BRAF, Smar, Hmgx2, BRAF35, Hmgxb2, AW610687, Smarce1r |
Peptide Sequence |
Synthetic peptide located within the following region: MSHGPRQPGAATAPAGGKTPGQHGAFVVAVKQERSEGSRAGEKGPQEEEP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Percec,I., et al., (2003) Genetics 164 (4), 1481-1494 |
Description of Target |
Hmg20b is the component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, AOF2/LSD1, RCOR1/CoREST and PHF21A/BHC80. Hmg20b is required for correct progression through G2 phase of the cell cycle and entry into mitosis Hmg20b is also required for RCOR1/CoREST mediated repression of neuronal specific gene promoters. |
Protein Interactions |
Rnf2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HMG20B (ARP37058_P050) antibody |
Blocking Peptide |
For anti-HMG20B (ARP37058_P050) antibody is Catalog # AAP37058 (Previous Catalog # AAPP09252) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q9Z104 |
Protein Name |
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related |
Protein Accession # |
NP_034570 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_010440 |
Tested Species Reactivity |
Human |
Gene Symbol |
HMG20B |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Human: 92%; Mouse: 100%; Rat: 100% |
Image 1 | Human Bladder
| WB Suggested Anti-HMG20B Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Bladder |
|
|