HMG20B Antibody - N-terminal region (ARP37058_P050)

Data Sheet
 
Product Number ARP37058_P050
Product Page www.avivasysbio.com/hmg20b-antibody-n-terminal-region-arp37058-p050.html
Name HMG20B Antibody - N-terminal region (ARP37058_P050)
Protein Size (# AA) 317 amino acids
Molecular Weight 35kDa
NCBI Gene Id 15353
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name High mobility group 20 B
Alias Symbols BRAF, Smar, Hmgx2, BRAF35, Hmgxb2, AW610687, Smarce1r
Peptide Sequence Synthetic peptide located within the following region: MSHGPRQPGAATAPAGGKTPGQHGAFVVAVKQERSEGSRAGEKGPQEEEP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Percec,I., et al., (2003) Genetics 164 (4), 1481-1494
Description of Target Hmg20b is the component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, AOF2/LSD1, RCOR1/CoREST and PHF21A/BHC80. Hmg20b is required for correct progression through G2 phase of the cell cycle and entry into mitosis Hmg20b is also required for RCOR1/CoREST mediated repression of neuronal specific gene promoters.
Protein Interactions Rnf2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HMG20B (ARP37058_P050) antibody
Blocking Peptide For anti-HMG20B (ARP37058_P050) antibody is Catalog # AAP37058 (Previous Catalog # AAPP09252)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q9Z104
Protein Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related
Protein Accession # NP_034570
Purification Affinity Purified
Nucleotide Accession # NM_010440
Tested Species Reactivity Human
Gene Symbol HMG20B
Predicted Species Reactivity Human, Mouse, Rat, Dog
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Human: 92%; Mouse: 100%; Rat: 100%
Image 1
Human Bladder
WB Suggested Anti-HMG20B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Bladder
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com