| Product Number |
ARP37025_T100 |
| Product Page |
www.avivasysbio.com/camk4-antibody-c-terminal-region-arp37025-t100.html |
| Name |
CAMK4 Antibody - C-terminal region (ARP37025_T100) |
| Protein Size (# AA) |
469 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
12326 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Calcium/calmodulin-dependent protein kinase IV |
| Alias Symbols |
CaM, CaMKI, CaMKIV, AI666733, CaMKIV/Gr, D18Bwg0362e, A430110E23Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: VKAVVASSRLGSASSSHTSIQENHKASSDPPSTQDAKDSTDLLGKKMQEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kitsos,C.M., et al., (2005) J. Biol. Chem. 280 (39), 33101-33108 |
| Description of Target |
CAMK4 plays key roles in the function and development of the cerebellu |
| Protein Interactions |
Kpna1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CAMK4 (ARP37025_T100) antibody |
| Blocking Peptide |
For anti-CAMK4 (ARP37025_T100) antibody is Catalog # AAP37025 (Previous Catalog # AAPP09223) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse CAMK4 |
| Uniprot ID |
P08414 |
| Protein Name |
Calcium/calmodulin-dependent protein kinase type IV |
| Protein Accession # |
NP_033923 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_009793 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CAMK4 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
| Image 1 | Human Thymus
 | WB Suggested Anti-CAMK4 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus |
|
|
