| Product Number |
ARP37014_T100 |
| Product Page |
www.avivasysbio.com/apex1-antibody-n-terminal-region-arp37014-t100.html |
| Name |
APEX1 Antibody - N-terminal region (ARP37014_T100) |
| Protein Size (# AA) |
317 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
11792 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Apurinic/apyrimidinic endonuclease 1 |
| Alias Symbols |
HA, APE, Apex, HAP1, Ref-, Ref-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: ETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSPSGKSATLKICSWNVDG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Izumi,T., et al., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (16), 5739-5743 |
| Description of Target |
Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. |
| Protein Interactions |
Pcna; Gadd45a; Eed; Mutyh; Plcb1; Hdac1; Sin3a; Hdac2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-APEX1 (ARP37014_T100) antibody |
| Blocking Peptide |
For anti-APEX1 (ARP37014_T100) antibody is Catalog # AAP37014 (Previous Catalog # AAPP09925) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse APEX1 |
| Uniprot ID |
Q544Z7 |
| Protein Name |
Apurinic/apyrimidinic endonuclease 1 EMBL EDL20835.1 |
| Protein Accession # |
NP_033817 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_009687 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
APEX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-APEX1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: SP2/0 cell lysate |
|
