ZFY1 Antibody - middle region (ARP37003_T100)

Data Sheet
 
Product Number ARP37003_T100
Product Page www.avivasysbio.com/zfy1-antibody-middle-region-arp37003-t100.html
Name ZFY1 Antibody - middle region (ARP37003_T100)
Protein Size (# AA) 782 amino acids
Molecular Weight 86kDa
NCBI Gene Id 22767
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger protein 1, Y linked
Alias Symbols Zfy2, Zfy-1
Peptide Sequence Synthetic peptide located within the following region: EQQMDVSEIKAAFLPIAWTAAYDNNSDEIEDQNVTASALLNQDESGGLDR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Jeong,K.S., et al., (2005) Biochem. Biophys. Res. Commun. 333 (3), 803-807
Description of Target Zfyl is a mouse Y chromosomal linked zinc finger protein which is thought to have some function during spermatogenesis
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZFY1 (ARP37003_T100) antibody
Blocking Peptide For anti-ZFY1 (ARP37003_T100) antibody is Catalog # AAP37003 (Previous Catalog # AAPP09894)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ZFY1
Uniprot ID P10925
Protein Name Zinc finger Y-chromosomal protein 1
Protein Accession # NP_033596
Purification Protein A purified
Nucleotide Accession # NM_009570
Tested Species Reactivity Mouse
Gene Symbol ZFY1
Predicted Species Reactivity Mouse
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%
Image 1
Mouse NIH-3T3
WB Suggested Anti-ZFY1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com