Product Number |
ARP37003_T100 |
Product Page |
www.avivasysbio.com/zfy1-antibody-middle-region-arp37003-t100.html |
Name |
ZFY1 Antibody - middle region (ARP37003_T100) |
Protein Size (# AA) |
782 amino acids |
Molecular Weight |
86kDa |
NCBI Gene Id |
22767 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 1, Y linked |
Alias Symbols |
Zfy2, Zfy-1 |
Peptide Sequence |
Synthetic peptide located within the following region: EQQMDVSEIKAAFLPIAWTAAYDNNSDEIEDQNVTASALLNQDESGGLDR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Jeong,K.S., et al., (2005) Biochem. Biophys. Res. Commun. 333 (3), 803-807 |
Description of Target |
Zfyl is a mouse Y chromosomal linked zinc finger protein which is thought to have some function during spermatogenesis |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZFY1 (ARP37003_T100) antibody |
Blocking Peptide |
For anti-ZFY1 (ARP37003_T100) antibody is Catalog # AAP37003 (Previous Catalog # AAPP09894) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse ZFY1 |
Uniprot ID |
P10925 |
Protein Name |
Zinc finger Y-chromosomal protein 1 |
Protein Accession # |
NP_033596 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_009570 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
ZFY1 |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-ZFY1 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: NIH/3T3 cell lysate |
|
|