| Product Number |
ARP36999_P050 |
| Product Page |
www.avivasysbio.com/vax1-antibody-middle-region-arp36999-p050.html |
| Name |
Vax1 Antibody - middle region (ARP36999_P050) |
| Protein Size (# AA) |
338 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
22326 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ventral anterior homeobox containing gene 1 |
| Alias Symbols |
MGC130490 |
| Peptide Sequence |
Synthetic peptide located within the following region: RERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Furimsky,M. (2006) Dev. Dyn. 235 (3), 594-605 |
| Description of Target |
Vax1 is required for axon guidance and major tract formation in the developing forebrain. It may contribute to the differentiation of the neuroretina, pigmented epithelium and optic stalk. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Vax1 (ARP36999_P050) antibody |
| Blocking Peptide |
For anti-Vax1 (ARP36999_P050) antibody is Catalog # AAP36999 (Previous Catalog # AAPS06705) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Vax1 |
| Uniprot ID |
Q2NKI2 |
| Protein Name |
Ventral anterior homeobox 1 |
| Protein Accession # |
NP_033527 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009501 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Vax1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-Vax1 Antibody Titration: 0.2-1 ug/ml
Positive Control: NIH/3T3 cell lysate |
|
|
