TOB1 Antibody - middle region (ARP36996_T100)

Data Sheet
 
Product Number ARP36996_T100
Product Page www.avivasysbio.com/tob1-antibody-middle-region-arp36996-t100.html
Name TOB1 Antibody - middle region (ARP36996_T100)
Protein Size (# AA) 362 amino acids
Molecular Weight 40kDa
NCBI Gene Id 22057
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transducer of ErbB-2.1
Alias Symbols To, Tr, Tob, Trob
Peptide Sequence Synthetic peptide located within the following region: QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhong,Z., et al., (2004) Oncogene 23 (39), 6630-6638
Description of Target Tob1 is a member of antiproliferative family proteins and acts as a bone morphogenic protein inhibitor as well as a suppressor of proliferation in T cells, which have been implicated in postmenopausal bone loss
Protein Interactions ctnnb2; smad3a; Smad9; Smad4; Smad5; Smad1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TOB1 (ARP36996_T100) antibody
Blocking Peptide For anti-TOB1 (ARP36996_T100) antibody is Catalog # AAP36996 (Previous Catalog # AAPP09192)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse TOB1
Uniprot ID Q640M3
Protein Name Protein Tob1 Ensembl ENSMUSP00000036039
Protein Accession # NP_033453
Purification Protein A purified
Nucleotide Accession # NM_009427
Tested Species Reactivity Mouse
Gene Symbol TOB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rat: 93%
Image 1
Mouse NIH-3T3
WB Suggested Anti-TOB1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com