Product Number |
ARP36996_T100 |
Product Page |
www.avivasysbio.com/tob1-antibody-middle-region-arp36996-t100.html |
Name |
TOB1 Antibody - middle region (ARP36996_T100) |
Protein Size (# AA) |
362 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
22057 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Transducer of ErbB-2.1 |
Alias Symbols |
To, Tr, Tob, Trob |
Peptide Sequence |
Synthetic peptide located within the following region: QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Zhong,Z., et al., (2004) Oncogene 23 (39), 6630-6638 |
Description of Target |
Tob1 is a member of antiproliferative family proteins and acts as a bone morphogenic protein inhibitor as well as a suppressor of proliferation in T cells, which have been implicated in postmenopausal bone loss |
Protein Interactions |
ctnnb2; smad3a; Smad9; Smad4; Smad5; Smad1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TOB1 (ARP36996_T100) antibody |
Blocking Peptide |
For anti-TOB1 (ARP36996_T100) antibody is Catalog # AAP36996 (Previous Catalog # AAPP09192) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse TOB1 |
Uniprot ID |
Q640M3 |
Protein Name |
Protein Tob1 Ensembl ENSMUSP00000036039 |
Protein Accession # |
NP_033453 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_009427 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
TOB1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rat: 93% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-TOB1 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: NIH/3T3 cell lysate |
|
|