| Product Number |
ARP36994_T100 |
| Product Page |
www.avivasysbio.com/thrb-antibody-n-terminal-region-arp36994-t100.html |
| Name |
Thrb Antibody - N-terminal region (ARP36994_T100) |
| Protein Size (# AA) |
475 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
21834 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Thyroid hormone receptor beta |
| Alias Symbols |
Nr, Nr1a2, T3R[b, T3Rbe, Thrb1, Thrb2, T3R[b], T3Rbeta, c-erbAb, c-erbAbeta |
| Peptide Sequence |
Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Furuya,F., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (6), 1780-1785 |
| Description of Target |
Thrb is high affinity receptor for triiodothyronine. |
| Protein Interactions |
Ncor1; Scand1; Nrip2; Pik3r1; Setdb1; Cops2; Ncoa1; Siah2; Rxrg; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Thrb (ARP36994_T100) antibody |
| Other Applications Image 1 Data |
Application: ChIP
Sample Type: mouse liver tissue
Chromatin Used: 100ug
Antibody Used: 10ug
Image Submitted by: Seo-hee You
University of Pennsylvania
|
| Blocking Peptide |
For anti-Thrb (ARP36994_T100) antibody is Catalog # AAP36994 (Previous Catalog # AAPP09190) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Thrb |
| Uniprot ID |
P37244 |
| Protein Name |
Thyroid hormone receptor beta |
| Protein Accession # |
NP_033406 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_009380 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Thrb |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse |
| Application |
CHIP, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 90%; Guinea Pig: 90%; Horse: 90%; Human: 90%; Mouse: 100%; Rat: 90% |
| Image 1 | Human SP2/0
 | WB Suggested Anti-Thrb Antibody Titration: 1.25ug/ml
Positive Control: SP2/0 cell lysate |
|
| Image 2 | Mouse Liver
 | Application: ChIP
Sample Type: mouse liver tissue
Chromatin Used: 100ug tissue
Antibody Used: 10ug
Image Submitted by: Joanna DiSpirito
University of Pennsylvania
|
|
| Image 3 | Mouse Liver
 | Application: ChIP
Sample Type: mouse liver tissue
Chromatin Used: 100ug tissue
Antibody Used: 10ug
Image Submitted by: Joanna DiSpirito
University of Pennsylvania
|
|
