| Product Number |
ARP36992_P050 |
| Product Page |
www.avivasysbio.com/tfam-antibody-middle-region-arp36992-p050.html |
| Name |
TFAM Antibody - middle region (ARP36992_P050) |
| Protein Size (# AA) |
243 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
21780 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transcription factor A, mitochondrial |
| Description |
|
| Alias Symbols |
Hmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103 |
| Peptide Sequence |
Synthetic peptide located within the following region: SESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Noack,H., et al., (2006) Biochim. Biophys. Acta 1760 (2), 141-150 |
| Description of Target |
TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells. |
| Protein Interactions |
C1QBP; SNCA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TFAM (ARP36992_P050) antibody |
| Blocking Peptide |
For anti-TFAM (ARP36992_P050) antibody is Catalog # AAP36992 (Previous Catalog # AAPP09188) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse TFAM |
| Uniprot ID |
P40630 |
| Protein Name |
Transcription factor A, mitochondrial |
| Protein Accession # |
NP_033386 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009360 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
TFAM |
| Predicted Species Reactivity |
Mouse, Rat, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rabbit: 77%; Rat: 93% |
| Image 1 | Human Fetal Kidney
 | Host: Rabbit
Target Name: Tfam
Sample Tissue: Human Fetal Kidney
Antibody Dilution: 1.0ug/ml |
|
|
