Tbr1 Antibody - N-terminal region (ARP36982_P050)

Data Sheet
 
Product Number ARP36982_P050
Product Page www.avivasysbio.com/tbr1-antibody-n-terminal-region-arp36982-p050.html
Name Tbr1 Antibody - N-terminal region (ARP36982_P050)
Protein Size (# AA) 681 amino acids
Molecular Weight 74
NCBI Gene Id 21375
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name T-box brain gene 1
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: PLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Tbr1 (ARP36982_P050) antibody
Additional Information IHC Information: Paraffin embedded mouse braintissue, tested with an antibody dilution of 5 ug/ml.
Blocking Peptide For anti-Tbr1 (ARP36982_P050) antibody is Catalog # AAP36982 (Previous Catalog # AAPP09178)
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of mouse Tbr1
Uniprot ID Q7TSY9
Protein Name T-box brain protein 1
Protein Accession # NP_033348
Purification Affinity Purified
Nucleotide Accession # NM_009322
Tested Species Reactivity Mouse
Gene Symbol Tbr1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Mouse Brain
Mouse Brain
Image 2
Mouse Uterus
WB Suggested Anti-Tbr1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Uterus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com