Product Number |
ARP36982_P050 |
Product Page |
www.avivasysbio.com/tbr1-antibody-n-terminal-region-arp36982-p050.html |
Name |
Tbr1 Antibody - N-terminal region (ARP36982_P050) |
Protein Size (# AA) |
681 amino acids |
Molecular Weight |
74 |
NCBI Gene Id |
21375 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
T-box brain gene 1 |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: PLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Tbr1 (ARP36982_P050) antibody |
Additional Information |
IHC Information: Paraffin embedded mouse braintissue, tested with an antibody dilution of 5 ug/ml. |
Blocking Peptide |
For anti-Tbr1 (ARP36982_P050) antibody is Catalog # AAP36982 (Previous Catalog # AAPP09178) |
Immunogen |
The immunogen is a synthetic peptide directed towards the n terminal region of mouse Tbr1 |
Uniprot ID |
Q7TSY9 |
Protein Name |
T-box brain protein 1 |
Protein Accession # |
NP_033348 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_009322 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Tbr1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Mouse Brain
| Mouse Brain |
| Image 2 | Mouse Uterus
| WB Suggested Anti-Tbr1 Antibody Titration: 0.2-1 ug/ml Positive Control: Mouse Uterus |
|
|