| Product Number |
ARP36981_P050 |
| Product Page |
www.avivasysbio.com/tal2-antibody-middle-region-arp36981-p050.html |
| Name |
Tal2 Antibody - middle region (ARP36981_P050) |
| Protein Size (# AA) |
108 amino acids |
| Molecular Weight |
12kDa |
| NCBI Gene Id |
21350 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
T cell acute lymphocytic leukemia 2 |
| Alias Symbols |
bHLHa, bHLHa19 |
| Peptide Sequence |
Synthetic peptide located within the following region: INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Lmo1; Lmo3; Runx1t1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Tal2 (ARP36981_P050) antibody |
| Blocking Peptide |
For anti-Tal2 (ARP36981_P050) antibody is Catalog # AAP36981 (Previous Catalog # AAPP09952) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q62282 |
| Protein Name |
T-cell acute lymphocytic leukemia protein 2 homolog |
| Protein Accession # |
NP_033343 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009317 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Tal2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Horse: 79%; Human: 93%; Mouse: 100%; Rabbit: 77%; Rat: 93% |
| Image 1 | Mouse Small Intestine
 | WB Suggested Anti-Tal2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Small Intestine |
|
|
