| Product Number |
ARP36979_T100 |
| Product Page |
www.avivasysbio.com/stat1-antibody-n-terminal-region-arp36979-t100.html |
| Name |
STAT1 Antibody - N-terminal region (ARP36979_T100) |
| Protein Size (# AA) |
749 amino acids |
| Molecular Weight |
82kDa |
| NCBI Gene Id |
20846 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Signal transducer and activator of transcription 1 |
| Alias Symbols |
AA408197, 2010005J02Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: QLQSWFTIVAETLQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mikhak,Z., et al., (2006) J. Immunol. 176 (8), 4959-4967 |
| Description of Target |
Stat1 is a member of the STAT family. It can form homodimers to modulate the transcriptional repression of PPARgamma2 in adipocytes |
| Protein Interactions |
Isg15; Sumo1; Zfp467; Stat1; Fbxo2; Mapk1; Ubc; Btrc; Atf3; Pdlim2; Stat3; Mllt10; SMURF2; SMURF1; TGFBR1; SMAD4; ACVR1; Il6st; Gfap; S100b; Ifng; Tbx21; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-STAT1 (ARP36979_T100) antibody |
| Blocking Peptide |
For anti-STAT1 (ARP36979_T100) antibody is Catalog # AAP36979 (Previous Catalog # AAPP09175) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse STAT1 |
| Uniprot ID |
P42225 |
| Protein Name |
Signal transducer and activator of transcription 1 |
| Protein Accession # |
NP_033309 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_009283 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
STAT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 86%; Mouse: 100%; Pig: 86%; Rabbit: 93%; Rat: 100%; Sheep: 86% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-STAT1 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate |
|
|
