Product Number |
ARP36977_P050 |
Product Page |
www.avivasysbio.com/sin3b-antibody-n-terminal-region-arp36977-p050.html |
Name |
Sin3b Antibody - N-terminal region (ARP36977_P050) |
Protein Size (# AA) |
954 amino acids |
Molecular Weight |
105kDa |
NCBI Gene Id |
20467 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transcriptional regulator, SIN3B (yeast) |
Alias Symbols |
2810430C10Rik |
Peptide Sequence |
Synthetic peptide located within the following region: LSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Nomura,M., (2005) J. Mol. Biol. 354 (4), 903-915 |
Description of Target |
Sin3B is one of the Sin3 co-repressors act as a protein scaffold to recruit transcription factors via its four highly homologous paired amphipathic helix (PAH) domains. |
Protein Interactions |
Hdac1; Phf12; Morf4l1; Cry1; Suds3; Myt1l; Myt1; Sin3a; Mnt; Mael; Rnf220; REST; Ifrd1; MXD1; IKZF1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Sin3b (ARP36977_P050) antibody |
Blocking Peptide |
For anti-Sin3b (ARP36977_P050) antibody is Catalog # AAP36977 (Previous Catalog # AAPP09173) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Sin3b |
Uniprot ID |
A1L326 |
Protein Accession # |
NP_033214 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_009188 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
Sin3b |
Predicted Species Reactivity |
Mouse, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 92% |
Image 1 | Human Thymus
| WB Suggested Anti-Sin3b Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Thymus |
| Image 2 | Mouse Spleen
| Host: Mouse Target Name: SIN3B Sample Tissue: Mouse Spleen Antibody Dilution: 1ug/ml |
|
|