Sin3b Antibody - N-terminal region (ARP36977_P050)

Data Sheet
 
Product Number ARP36977_P050
Product Page www.avivasysbio.com/sin3b-antibody-n-terminal-region-arp36977-p050.html
Name Sin3b Antibody - N-terminal region (ARP36977_P050)
Protein Size (# AA) 954 amino acids
Molecular Weight 105kDa
NCBI Gene Id 20467
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcriptional regulator, SIN3B (yeast)
Alias Symbols 2810430C10Rik
Peptide Sequence Synthetic peptide located within the following region: LSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nomura,M., (2005) J. Mol. Biol. 354 (4), 903-915
Description of Target Sin3B is one of the Sin3 co-repressors act as a protein scaffold to recruit transcription factors via its four highly homologous paired amphipathic helix (PAH) domains.
Protein Interactions Hdac1; Phf12; Morf4l1; Cry1; Suds3; Myt1l; Myt1; Sin3a; Mnt; Mael; Rnf220; REST; Ifrd1; MXD1; IKZF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Sin3b (ARP36977_P050) antibody
Blocking Peptide For anti-Sin3b (ARP36977_P050) antibody is Catalog # AAP36977 (Previous Catalog # AAPP09173)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse Sin3b
Uniprot ID A1L326
Protein Accession # NP_033214
Purification Affinity Purified
Nucleotide Accession # NM_009188
Tested Species Reactivity Human, Mouse
Gene Symbol Sin3b
Predicted Species Reactivity Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 92%
Image 1
Human Thymus
WB Suggested Anti-Sin3b Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus
Image 2
Mouse Spleen
Host: Mouse
Target Name: SIN3B
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com